A0A8B8JP57 · A0A8B8JP57_ABRPR
- ProteinSmall ribosomal subunit protein uS11c
- GeneLOC113847446
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids431 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
Catalytic activity
- a ribonucleoside 5'-triphosphate + RNA(n) = diphosphate + RNA(n+1)
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Cellular Component | DNA-directed RNA polymerase complex | |
Cellular Component | ribonucleoprotein complex | |
Cellular Component | ribosome | |
Molecular Function | DNA binding | |
Molecular Function | DNA-directed 5'-3' RNA polymerase activity | |
Molecular Function | protein dimerization activity | |
Molecular Function | rRNA binding | |
Molecular Function | structural constituent of ribosome | |
Biological Process | DNA-templated transcription | |
Biological Process | translation |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSmall ribosomal subunit protein uS11c
- EC number
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > fabids > Fabales > Fabaceae > Papilionoideae > 50 kb inversion clade > NPAAA clade > indigoferoid/millettioid clade > Abreae > Abrus
Accessions
- Primary accessionA0A8B8JP57
Proteomes
Subcellular Location
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-22 | Disordered | ||||
Sequence: MAKPIPKMGSRKNGRIGSRKHA | ||||||
Domain | 152-338 | DNA-directed RNA polymerase RpoA/D/Rpb3-type | ||||
Sequence: YGRFILSPLMKGQADTIGIAVRRVLLGEIEGTCITRAKSEKIPHEYSTIVGIQESVHEILMNLKEIVLRSNLYGTQDASICFKGPGYITAQDIILPPSVEIIDNTQHIANLTEPINLCIGLKIERNRGYRIKTLKNFQDGSFPIDAVFMPVRNVNHSIHSYGNGKKKQEILFLEIWTNGKEDPFHLE |
Sequence similarities
Belongs to the RNA polymerase alpha chain family.
Belongs to the universal ribosomal protein uS11 family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length431
- Mass (Da)48,657
- Last updated2022-01-19 v1
- ChecksumB1471ED6CC0797A1
Keywords
- Technical term