A0A833SEP0 · A0A833SEP0_9CERV

Function

Caution

The sequence shown here is derived from an EMBL/GenBank/DDBJ whole genome shotgun (WGS) entry which is preliminary data.

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular Componentcytoplasm
Cellular Componentnucleus
Molecular Functionnon-membrane spanning protein tyrosine phosphatase activity
Biological Processnegative regulation of nucleotide-binding oligomerization domain containing 2 signaling pathway
Biological Processnegative regulation of p38MAPK cascade
Biological Processnegative regulation of T cell activation
Biological Processnegative regulation of tumor necrosis factor production
Biological Processpeptidyl-tyrosine dephosphorylation
Biological Processpositive regulation of CD8-positive, alpha-beta T cell proliferation
Biological Processpositive regulation of defense response to virus by host
Biological Processpositive regulation of ERK1 and ERK2 cascade
Biological Processpositive regulation of granzyme B production
Biological Processpositive regulation of protein K63-linked ubiquitination
Biological Processpositive regulation of toll-like receptor 3 signaling pathway
Biological Processpositive regulation of toll-like receptor 4 signaling pathway
Biological Processpositive regulation of toll-like receptor 7 signaling pathway
Biological Processpositive regulation of toll-like receptor 9 signaling pathway
Biological Processregulation of non-canonical NF-kappaB signal transduction
Biological ProcessT cell differentiation
Biological ProcessT cell receptor signaling pathway

Keywords

Enzyme and pathway databases

Names & Taxonomy

Protein names

  • Recommended name
    protein-tyrosine-phosphatase
  • EC number

Gene names

    • ORF names
      G4228_020288

Organism names

  • Taxonomic identifier
  • Strain
    • CEY-2017
  • Taxonomic lineage
    Eukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Laurasiatheria > Artiodactyla > Ruminantia > Pecora > Cervidae > Cervinae > Cervus

Accessions

  • Primary accession
    A0A833SEP0

Proteomes

Subcellular Location

Family & Domains

Features

Showing features for domain.

TypeIDPosition(s)Description
Domain1-181Tyrosine-protein phosphatase
Domain129-181Tyrosine specific protein phosphatases

Sequence similarities

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Length
    181
  • Mass (Da)
    20,858
  • Last updated
    2021-09-29 v1
  • MD5 Checksum
    6B7B1D680B9CAD08FE4600DB53EB6EA0
MITSDEDSSYINANFIKGVYGPKTYIATQGPLPTTILDFWRMIWEYSILIIVMACMEFEMGKKKCERYWAEPGDTQLQLGPFSISCEAENRKSDYTIRTLKAKFNSETRTIYQFHYKNWPDHDVPSSIDPILELIWDVRCYQDDNSVPICIHCSAGCGRTGVLCAIDYTWMLLKDGVSFSQ

Keywords

Sequence databases

Nucleotide SequenceProtein SequenceMolecule TypeStatus
WMHW01002226
EMBL· GenBank· DDBJ
KAF4008534.1
EMBL· GenBank· DDBJ
Genomic DNA

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
Help