A0A804HIN3 · A0A804HIN3_HUMAN
- ProteinKalirin RhoGEF kinase
- GeneKALRN
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids1000 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score1/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | guanyl-nucleotide exchange factor activity |
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Taxonomic lineagecellular organisms > Eukaryota (eucaryotes) > Opisthokonta > Metazoa (metazoans) > Eumetazoa > Bilateria > Deuterostomia > Chordata (chordates) > Craniata > Vertebrata (vertebrates) > Gnathostomata (jawed vertebrates) > Teleostomi > Euteleostomi (bony vertebrates) > Sarcopterygii > Dipnotetrapodomorpha > Tetrapoda (tetrapods) > Amniota (amniotes) > Mammalia (mammals) > Theria > Eutheria (placentals) > Boreoeutheria > Euarchontoglires > Primates > Haplorrhini > Simiiformes > Catarrhini > Hominoidea (apes) > Hominidae (great apes) > Homininae > Homo
Accessions
- Primary accessionA0A804HIN3
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 673 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
PTM/Processing
Features
Showing features for modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Modified residue (large scale data) | 31 | PRIDE | Phosphoserine | ||||
Sequence: S |
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for coiled coil, domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Coiled coil | 265-292 | |||||
Sequence: NASSLSEAEQLQREHEQFQLAIEKTHQS | ||||||
Domain | 618-793 | DH | ||||
Sequence: KKEFIMAELLQTEKAYVRDLHECLETYLWEMTSGVEEIPPGILNKEHIIFGNIQEIYDFHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDSNQLILEHAGTFFDEIQQRHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGKGELKDGLEVMLSVPKKANDA | ||||||
Domain | 805-917 | PH | ||||
Sequence: NLDVQGELILQDAFQVWDPKSLIRKGRERHLFLFEISLVFSKEIKDSSGHTKYVYKNKLLTSELGVTEHVEGDPCKFALWSGRTPSSDNKTVLKASNIETKQEWIKNIREVIQ | ||||||
Region | 931-1000 | Disordered | ||||
Sequence: LQLPKTPAKQRNNSKRDGVEDIDSQGDGSSQPDTISIASRTSQNTVDSDKDGNLVPRWHLGPGDPFSTYV | ||||||
Compositional bias | 954-980 | Polar residues | ||||
Sequence: SQGDGSSQPDTISIASRTSQNTVDSDK |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,000
- Mass (Da)115,713
- Last updated2021-09-29 v1
- Checksum4B8F7363164C28E3
Computationally mapped potential isoform sequences
There are 25 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
O60229 | KALRN_HUMAN | KALRN | 2986 | ||
C9IZQ6 | C9IZQ6_HUMAN | KALRN | 1654 | ||
C9J1B4 | C9J1B4_HUMAN | KALRN | 194 | ||
A0A804HI83 | A0A804HI83_HUMAN | KALRN | 1092 | ||
A0A804HI91 | A0A804HI91_HUMAN | KALRN | 1022 | ||
A0A804HHT5 | A0A804HHT5_HUMAN | KALRN | 44 | ||
A0A804HI42 | A0A804HI42_HUMAN | KALRN | 103 | ||
A0A804HJ49 | A0A804HJ49_HUMAN | KALRN | 1041 | ||
A0A804HIP9 | A0A804HIP9_HUMAN | KALRN | 1005 | ||
A0A804HIY9 | A0A804HIY9_HUMAN | KALRN | 890 | ||
A0A804HJ74 | A0A804HJ74_HUMAN | KALRN | 189 | ||
A0A804HII1 | A0A804HII1_HUMAN | KALRN | 1198 | ||
A0A804HIK8 | A0A804HIK8_HUMAN | KALRN | 939 | ||
A0A0D9SGH1 | A0A0D9SGH1_HUMAN | KALRN | 53 | ||
A0A804HLI0 | A0A804HLI0_HUMAN | KALRN | 2986 | ||
H7BXZ5 | H7BXZ5_HUMAN | KALRN | 2955 | ||
A0A804HLC8 | A0A804HLC8_HUMAN | KALRN | 98 | ||
A0A804HLF3 | A0A804HLF3_HUMAN | KALRN | 1059 | ||
A0A804HJX0 | A0A804HJX0_HUMAN | KALRN | 545 | ||
A0A804HJZ3 | A0A804HJZ3_HUMAN | KALRN | 45 | ||
A0A804HJC5 | A0A804HJC5_HUMAN | KALRN | 1008 | ||
A0A804HKU9 | A0A804HKU9_HUMAN | KALRN | 145 | ||
A0A804HKT9 | A0A804HKT9_HUMAN | KALRN | 1613 | ||
A0A804HKJ7 | A0A804HKJ7_HUMAN | KALRN | 709 | ||
H7C1X7 | H7C1X7_HUMAN | KALRN | 215 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 954-980 | Polar residues | ||||
Sequence: SQGDGSSQPDTISIASRTSQNTVDSDK |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC022336 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC069233 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC080008 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC112129 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC117381 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC117401 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
KF457679 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |