A0A804HIE1 · A0A804HIE1_HUMAN
- ProteinBardet-Biedl syndrome 2 protein homolog
- GeneBBS2
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids721 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | BBSome | |
Cellular Component | centriolar satellite | |
Cellular Component | ciliary membrane | |
Cellular Component | cytoplasm | |
Biological Process | non-motile cilium assembly |
Names & Taxonomy
Protein names
- Recommended nameBardet-Biedl syndrome 2 protein homolog
Gene names
Organism names
- Organism
- Taxonomic lineagecellular organisms > Eukaryota (eucaryotes) > Opisthokonta > Metazoa (metazoans) > Eumetazoa > Bilateria > Deuterostomia > Chordata (chordates) > Craniata > Vertebrata (vertebrates) > Gnathostomata (jawed vertebrates) > Teleostomi > Euteleostomi (bony vertebrates) > Sarcopterygii > Dipnotetrapodomorpha > Tetrapoda (tetrapods) > Amniota (amniotes) > Mammalia (mammals) > Theria > Eutheria (placentals) > Boreoeutheria > Euarchontoglires > Primates > Haplorrhini > Simiiformes > Catarrhini > Hominoidea (apes) > Hominidae (great apes) > Homininae > Homo
Accessions
- Primary accessionA0A804HIE1
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 809 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Genetic variation databases
PTM/Processing
Features
Showing features for modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Modified residue (large scale data) | 365 | PRIDE | Phosphoserine | ||||
Sequence: S |
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 20-126 | Ciliary BBSome complex subunit 2 N-terminal | ||||
Sequence: AIGRYDGTHPCLAAATQTGKVFIHNPHTRNQHVSASRVFQSPLESDVSLLSINQAVSCLTAGVLNPELGYDALLVGTQTNLLAYDVYNNSDLFYREVADGANAIVLG | ||||||
Domain | 165-272 | Ciliary BBSome complex subunit 2 middle region | ||||
Sequence: SLALCDFDGDGKKELLVGSEDFDIRVFKEDEIVAEMTETEIVTSLCPMYGSRFGYALSNGTVGVYDKTSRYWRIKSKNHAMSIHAFDLNSDGVNELITGWSNGKVDAR | ||||||
Domain | 276-715 | Ciliary BBSome complex subunit 2 C-terminal | ||||
Sequence: TGEVIFKDNFSSAIAGVVEGDYRMDGHIQLICCSVDGEIRGYLPGTAEMRGNLMDTSAEQDLIRELSQKKQNLLLELRNYEENAKAELASPLNEADGHRGIIPANTRLHTTLSVSLGNETQTAHTELRISTSNDTIIRAVLIFAEGIFTGESHVVHPSIHNLSSSICIPIVPPKDVPVDLHLKAFVGYRSSTQFHVFESTRQLPRFSMYALTSLDPASEPISYVNFTIAERAQRVVVWLGQNFLLPEDTHIQNAPFQVCFTSLRNGGHLHIKIKLSGEITINTDDIDLAGDIIQSMASFFAIEDLQVEADFPVYFEELRKVLVKVDEYHSVHQKLSADMADHSNLIRSLLVGAEDARLMRDMKTMKSRYMELYDLNRDLLNGYKIRCNNHTELLGNLKAVNQAIQRAGRLRVGKPKNQVITACRDAIRSNNINTLFKIMR | ||||||
Coiled coil | 338-365 | |||||
Sequence: IRELSQKKQNLLLELRNYEENAKAELAS |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length721
- Mass (Da)79,844
- Last updated2021-09-29 v1
- ChecksumEF97CAA28709A089
Computationally mapped potential isoform sequences
There are 27 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q9BXC9 | BBS2_HUMAN | BBS2 | 721 | ||
H3BRL0 | H3BRL0_HUMAN | BBS2 | 675 | ||
H3BQ79 | H3BQ79_HUMAN | BBS2 | 49 | ||
H3BNS7 | H3BNS7_HUMAN | BBS2 | 121 | ||
A0A804HHV5 | A0A804HHV5_HUMAN | BBS2 | 509 | ||
A0A804HI33 | A0A804HI33_HUMAN | BBS2 | 522 | ||
A0A804HJ30 | A0A804HJ30_HUMAN | BBS2 | 686 | ||
A0A804HIQ9 | A0A804HIQ9_HUMAN | BBS2 | 158 | ||
A0A804HIZ8 | A0A804HIZ8_HUMAN | BBS2 | 264 | ||
A0A804HIK5 | A0A804HIK5_HUMAN | BBS2 | 460 | ||
A0A804HIE0 | A0A804HIE0_HUMAN | BBS2 | 237 | ||
A0A804HLC6 | A0A804HLC6_HUMAN | BBS2 | 38 | ||
A0A804HLD7 | A0A804HLD7_HUMAN | BBS2 | 162 | ||
A0A804HLF5 | A0A804HLF5_HUMAN | BBS2 | 198 | ||
A0A804HLL2 | A0A804HLL2_HUMAN | BBS2 | 243 | ||
A0A804HK50 | A0A804HK50_HUMAN | BBS2 | 659 | ||
A0A804HK51 | A0A804HK51_HUMAN | BBS2 | 312 | ||
A0A804HJQ5 | A0A804HJQ5_HUMAN | BBS2 | 645 | ||
A0A804HK25 | A0A804HK25_HUMAN | BBS2 | 510 | ||
A0A804HJV0 | A0A804HJV0_HUMAN | BBS2 | 736 | ||
A0A804HJV2 | A0A804HJV2_HUMAN | BBS2 | 705 | ||
A0A804HK97 | A0A804HK97_HUMAN | BBS2 | 367 | ||
A0A804HKF2 | A0A804HKF2_HUMAN | BBS2 | 679 | ||
A0A804HKG1 | A0A804HKG1_HUMAN | BBS2 | 361 | ||
A0A804HKL9 | A0A804HKL9_HUMAN | BBS2 | 696 | ||
A0A804HKI7 | A0A804HKI7_HUMAN | BBS2 | 428 | ||
A0A804F8L3 | A0A804F8L3_HUMAN | BBS2 | 55 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC009155 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC026461 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC092140 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |