A0A7W9U2V2 · A0A7W9U2V2_9BURK
- ProteinGlycerol kinase
- GeneglpK
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids501 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Key enzyme in the regulation of glycerol uptake and metabolism. Catalyzes the phosphorylation of glycerol to yield sn-glycerol 3-phosphate.
Catalytic activity
- ATP + glycerol = ADP + H+ + sn-glycerol 3-phosphate
Activity regulation
Inhibited by fructose 1,6-bisphosphate (FBP).
Pathway
Polyol metabolism; glycerol degradation via glycerol kinase pathway; sn-glycerol 3-phosphate from glycerol: step 1/1.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 14 | ADP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 14 | ATP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 14 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 15 | ATP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 16 | ATP (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 18 | ADP (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 84 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 84 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 85 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 85 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 136 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 136 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 245 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 245 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 246 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: Q | ||||||
Binding site | 267 | ADP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 267 | ATP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 310 | ADP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 310 | ATP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 314 | ATP (UniProtKB | ChEBI) | ||||
Sequence: Q | ||||||
Binding site | 411 | ADP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 411 | ATP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 415 | ADP (UniProtKB | ChEBI) | ||||
Sequence: N |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Molecular Function | ATP binding | |
Molecular Function | glycerol kinase activity | |
Biological Process | glycerol catabolic process | |
Biological Process | glycerol-3-phosphate metabolic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameGlycerol kinase
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageBacteria > Pseudomonadota > Betaproteobacteria > Burkholderiales > Burkholderiaceae > Paraburkholderia
Accessions
- Primary accessionA0A7W9U2V2
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 6-252 | Carbohydrate kinase FGGY N-terminal | ||||
Sequence: YILALDQGTTSSRAMLFDRQGRIVSTAQKEFEQIYPRPGWVEHDPQEIWSTQAGVAAEAVTRAGMNGTNIAAIGITNQRETTIVWDRETGQPIYNAIVWQDRRTADFCDQLKAQGLEEKVRAKTGLPIDSYFSGTKIRWILDNVEGAREKARQGKLAFGTVDSWLVWNFTKHELHVTDVTNASRTMLFNIHTRQWDNELLEALDIPRNMLPEVRSSSEIYGPTKTTVFASKIPLAGIAGDQQAALFG | ||||||
Domain | 262-450 | Carbohydrate kinase FGGY C-terminal | ||||
Sequence: KNTYGTGCFLMMNTGDKPIESKNNLVTTIAWQIGDQVNYALEGSIFIAGAVVQWLRDGMGIIKSASEIEALAASVPHTDGVYLVPAFAGLGAPHWNARARGSLFGVTRGTTSAHVARAALDSIAYQSLDVLAAMEADSGISVGELRVDGGASANNLLMQFQADLLGVDAVRPQITETTALGAAYLAGLA |
Sequence similarities
Belongs to the FGGY kinase family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length501
- Mass (Da)54,726
- Last updated2021-06-02 v1
- Checksum2869E826DA40760D