A0A7W5FZA4 · A0A7W5FZA4_9HYPH
- ProteinBifunctional enzyme IspD/IspF
- GeneispDF
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids402 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
Bifunctional enzyme that catalyzes the formation of 4-diphosphocytidyl-2-C-methyl-D-erythritol from CTP and 2-C-methyl-D-erythritol 4-phosphate (MEP) (IspD), and catalyzes the conversion of 4-diphosphocytidyl-2-C-methyl-D-erythritol 2-phosphate (CDP-ME2P) to 2-C-methyl-D-erythritol 2,4-cyclodiphosphate (ME-CPP) with a corresponding release of cytidine 5-monophosphate (CMP) (IspF).
Catalytic activity
- 2-C-methyl-D-erythritol 4-phosphate + CTP + H+ = 4-CDP-2-C-methyl-D-erythritol + diphosphate
Cofactor
Pathway
Isoprenoid biosynthesis; isopentenyl diphosphate biosynthesis via DXP pathway; isopentenyl diphosphate from 1-deoxy-D-xylulose 5-phosphate: step 2/6.
Isoprenoid biosynthesis; isopentenyl diphosphate biosynthesis via DXP pathway; isopentenyl diphosphate from 1-deoxy-D-xylulose 5-phosphate: step 4/6.
Features
Showing features for site, binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 21 | Transition state stabilizer | ||||
Sequence: R | ||||||
Site | 30 | Transition state stabilizer | ||||
Sequence: K | ||||||
Site | 164 | Positions MEP for the nucleophilic attack | ||||
Sequence: R | ||||||
Site | 221 | Positions MEP for the nucleophilic attack | ||||
Sequence: K | ||||||
Binding site | 250 | a divalent metal cation (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 250-252 | 4-CDP-2-C-methyl-D-erythritol 2-phosphate (UniProtKB | ChEBI) | ||||
Sequence: DVH | ||||||
Binding site | 252 | a divalent metal cation (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Site | 276 | Transition state stabilizer | ||||
Sequence: H | ||||||
Binding site | 276-277 | 4-CDP-2-C-methyl-D-erythritol 2-phosphate (UniProtKB | ChEBI) | ||||
Sequence: HS | ||||||
Binding site | 284 | a divalent metal cation (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 298-300 | 4-CDP-2-C-methyl-D-erythritol 2-phosphate (UniProtKB | ChEBI) | ||||
Sequence: DIG | ||||||
Binding site | 374-377 | 4-CDP-2-C-methyl-D-erythritol 2-phosphate (UniProtKB | ChEBI) | ||||
Sequence: TTNE | ||||||
Site | 375 | Transition state stabilizer | ||||
Sequence: T | ||||||
Binding site | 381 | 4-CDP-2-C-methyl-D-erythritol 2-phosphate (UniProtKB | ChEBI) | ||||
Sequence: F | ||||||
Binding site | 384 | 4-CDP-2-C-methyl-D-erythritol 2-phosphate (UniProtKB | ChEBI) | ||||
Sequence: R |
GO annotations
Aspect | Term | |
---|---|---|
Molecular Function | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase activity | |
Molecular Function | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase activity | |
Molecular Function | metal ion binding | |
Biological Process | isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway | |
Biological Process | terpenoid biosynthetic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameBifunctional enzyme IspD/IspF
Including 2 domains:
- Recommended name2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
- EC number
- Alternative names
- Recommended name2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
- EC number
- Short namesMECDP-synthase ; MECPP-synthase ; MECPS
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageBacteria > Pseudomonadota > Alphaproteobacteria > Hyphomicrobiales > Rhizobiaceae > Rhizobium/Agrobacterium group > Rhizobium
Accessions
- Primary accessionA0A7W5FZA4
Proteomes
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-243 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase | ||||
Sequence: MPSKQPISAGIVIVAAGRGERAGSSKEGPKQYRMIGGKPVIVHTLENFMTWELATQIVVVIHPDDEALFARALRHIISATPIETVHGGATRQQSVLAGLKYLKDKHVSHVLIHDAVRPFFDHVLLDRIAESLGDGAPAVLPAMPVTDTLKRTDSAGTVLATVSRESLYAAQTPQSFAFETILDAHEKAAASGRSDFTDDASIAEWLGIPVTIVEGTADNVKLTVRSDIAKADDKLSASLLPDV | ||||||
Domain | 244-396 | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | ||||
Sequence: RTGNGYDVHQLVAGDGVTLCGVFIPHDQKLKGHSDADVALHALTDALLATCGAGDIGDHFPPSDPQWKGAASKIFIEHAARIVRERGGTIMNADVSLIAEAPKIGPHRDAMRAKLSDYLGIDIERCSVKATTNETIGFVGRREGIAAIATATV | ||||||
Region | 244-402 | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | ||||
Sequence: RTGNGYDVHQLVAGDGVTLCGVFIPHDQKLKGHSDADVALHALTDALLATCGAGDIGDHFPPSDPQWKGAASKIFIEHAARIVRERGGTIMNADVSLIAEAPKIGPHRDAMRAKLSDYLGIDIERCSVKATTNETIGFVGRREGIAAIATATVVYRGRK |
Sequence similarities
Belongs to the IspD/TarI cytidylyltransferase family. IspD subfamily.
Belongs to the IspF family.
In the C-terminal section; belongs to the IspF family.
In the N-terminal section; belongs to the IspD/TarI cytidylyltransferase family. IspD subfamily.
Family and domain databases
Sequence
- Sequence statusComplete
- Length402
- Mass (Da)42,840
- Last updated2021-06-02 v1
- Checksum1CED2CC30FD48260