A0A7W3LIQ5 · A0A7W3LIQ5_ACTNM
- ProteinSmall ribosomal subunit biogenesis GTPase RsgA
- GenersgA
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids330 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | GTP binding | |
Molecular Function | GTPase activity | |
Molecular Function | rRNA binding | |
Biological Process | ribosomal small subunit biogenesis |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSmall ribosomal subunit biogenesis GTPase RsgA
- EC number
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageBacteria > Actinomycetota > Actinomycetes > Streptosporangiales > Thermomonosporaceae > Actinomadura
Accessions
- Primary accessionA0A7W3LIQ5
Proteomes
Subcellular Location
Interaction
Subunit
Monomer. Associates with 30S ribosomal subunit, binds 16S rRNA.
Structure
Family & Domains
Features
Showing features for compositional bias, region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-19 | Basic and acidic residues | ||||
Sequence: MARRARDYDEDDVRVRPSR | ||||||
Region | 1-29 | Disordered | ||||
Sequence: MARRARDYDEDDVRVRPSRRGSRPRTRIR | ||||||
Domain | 109-263 | CP-type G | ||||
Sequence: TDPFERIIVANADQLAIVTALADPEPRPRLIDRQLVAAYDAGMHPLLVLTKADLADPDALLAEYASLGVPAFVTQRGGDLAGLRDLLRGQITVLVGHSGVGKSTLVNALVPDAERAVSHVNAVTGRGRHTSSSALALELPDGEGWIIDTPGVRSF | ||||||
Domain | 118-261 | EngC GTPase | ||||
Sequence: ANADQLAIVTALADPEPRPRLIDRQLVAAYDAGMHPLLVLTKADLADPDALLAEYASLGVPAFVTQRGGDLAGLRDLLRGQITVLVGHSGVGKSTLVNALVPDAERAVSHVNAVTGRGRHTSSSALALELPDGEGWIIDTPGVR |
Sequence similarities
Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.
Family and domain databases
Sequence
- Sequence statusComplete
- Length330
- Mass (Da)35,801
- Last updated2021-06-02 v1
- Checksum0A7D39C3B51D4561
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-19 | Basic and acidic residues | ||||
Sequence: MARRARDYDEDDVRVRPSR |
Keywords
- Technical term