A0A7U3VM37 · A0A7U3VM37_9ACTN

Function

function

Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.

Activity regulation

The formation of the proteasomal ATPase ARC-20S proteasome complex, likely via the docking of the C-termini of ARC into the intersubunit pockets in the alpha-rings, may trigger opening of the gate for substrate entry. Interconversion between the open-gate and close-gate conformations leads to a dynamic regulation of the 20S proteasome proteolysis activity.

Pathway

Protein degradation; proteasomal Pup-dependent pathway.

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular Componentcytoplasm
Cellular Componentproteasome core complex, alpha-subunit complex
Molecular Functionthreonine-type endopeptidase activity
Biological Processmodification-dependent protein catabolic process
Biological Processproteasomal protein catabolic process

Enzyme and pathway databases

Names & Taxonomy

Protein names

  • Recommended name
    Proteasome subunit alpha
  • Alternative names
    • 20S proteasome alpha subunit
    • Proteasome core protein PrcA

Gene names

    • Name
      prcA
    • ORF names
      RVR_1336

Organism names

  • Taxonomic identifier
  • Organism
  • Strain
    • SN-593
  • Taxonomic lineage
    Bacteria > Actinomycetota > Actinomycetes > Kitasatosporales > Streptomycetaceae > Streptomyces

Accessions

  • Primary accession
    A0A7U3VM37

Proteomes

Subcellular Location

Keywords

Interaction

Subunit

The 20S proteasome core is composed of 14 alpha and 14 beta subunits that assemble into four stacked heptameric rings, resulting in a barrel-shaped structure. The two inner rings, each composed of seven catalytic beta subunits, are sandwiched by two outer rings, each composed of seven alpha subunits. The catalytic chamber with the active sites is on the inside of the barrel. Has a gated structure, the ends of the cylinder being occluded by the N-termini of the alpha-subunits. Is capped by the proteasome-associated ATPase, ARC.

Family & Domains

Sequence similarities

Belongs to the peptidase T1A family.

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Length
    249
  • Mass (Da)
    27,444
  • Last updated
    2021-09-29 v1
  • Checksum
    41BD36629A8F9E7F
MSTPFYVSPQQAMADRAEYARKGIARGRSVVVLQYTDGIVFVAENPSRALHKVSEIYDRIAFAAVGKYNEFENLRIGGVRYADLRGYTYDRDDVTARGLANVYAQTLGTIFSSVGEKPYEVELIVAEVGAAPEDDQIYRLPHDGSIVDEHGAVAVGGNSDQIGSYLDQRHRDGMTLAEALALAVESLGRDANGGSDRQLTAEQLEVAVLDRTRPQQRKFRRILGRQLSRLLDTESAATTKTDEPSDEEE

Keywords

Sequence databases

Nucleotide SequenceProtein SequenceMolecule TypeStatus
AP018365
EMBL· GenBank· DDBJ
BBA96162.1
EMBL· GenBank· DDBJ
Genomic DNA

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
Help