A0A7P0TAX9 · A0A7P0TAX9_HUMAN
- Proteinprotein disulfide-isomerase
- GeneP4HB
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids222 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
Catalytic activity
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum lumen | |
Cellular Component | melanosome | |
Molecular Function | protein disulfide isomerase activity |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameprotein disulfide-isomerase
- EC number
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionA0A7P0TAX9
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 210 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Signal | 1-17 | UniProt | |||||
Sequence: MLRRALLCLAVAALVRA | |||||||
Chain | PRO_5030832376 | 18-222 | UniProt | protein disulfide-isomerase | |||
Sequence: DAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKDGVVLFKKRRGFTVLARVVSNS | |||||||
Modified residue (large scale data) | 32 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 88 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 101 | PRIDE | Phosphothreonine | ||||
Sequence: T |
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 8-134 | Thioredoxin | ||||
Sequence: CLAVAALVRADAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTG |
Sequence similarities
Belongs to the protein disulfide isomerase family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length222
- Mass (Da)24,207
- Last updated2021-06-02 v1
- ChecksumFBA21E97667CC554
Computationally mapped potential isoform sequences
There are 31 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
P07237 | PDIA1_HUMAN | P4HB | 508 | ||
A0A7P0T9D6 | A0A7P0T9D6_HUMAN | P4HB | 521 | ||
A0A7P0T9E3 | A0A7P0T9E3_HUMAN | P4HB | 74 | ||
A0A7P0T9K9 | A0A7P0T9K9_HUMAN | P4HB | 439 | ||
A0A7P0T9S9 | A0A7P0T9S9_HUMAN | P4HB | 135 | ||
A0A7P0T9U6 | A0A7P0T9U6_HUMAN | P4HB | 486 | ||
A0A7P0T8C0 | A0A7P0T8C0_HUMAN | P4HB | 481 | ||
A0A7P0T8J3 | A0A7P0T8J3_HUMAN | P4HB | 488 | ||
A0A7P0T940 | A0A7P0T940_HUMAN | P4HB | 66 | ||
A0A7P0T8X1 | A0A7P0T8X1_HUMAN | P4HB | 479 | ||
H0Y3Z3 | H0Y3Z3_HUMAN | P4HB | 418 | ||
A0A7P0TBA3 | A0A7P0TBA3_HUMAN | P4HB | 59 | ||
A0A7P0TBP8 | A0A7P0TBP8_HUMAN | P4HB | 123 | ||
A0A7P0TA35 | A0A7P0TA35_HUMAN | P4HB | 542 | ||
A0A7P0TA71 | A0A7P0TA71_HUMAN | P4HB | 557 | ||
A0A7P0TA97 | A0A7P0TA97_HUMAN | P4HB | 479 | ||
A0A7P0TB26 | A0A7P0TB26_HUMAN | P4HB | 533 | ||
H7BZ94 | H7BZ94_HUMAN | P4HB | 464 | ||
A0A7P0Z4J0 | A0A7P0Z4J0_HUMAN | P4HB | 270 | ||
A0A7P0Z4S2 | A0A7P0Z4S2_HUMAN | P4HB | 304 | ||
A0A7P0Z476 | A0A7P0Z476_HUMAN | P4HB | 126 | ||
A0A7P0Z4B2 | A0A7P0Z4B2_HUMAN | P4HB | 62 | ||
A0A7P0Z4F8 | A0A7P0Z4F8_HUMAN | P4HB | 48 | ||
I3NI03 | I3NI03_HUMAN | P4HB | 118 | ||
B3KTQ9 | B3KTQ9_HUMAN | P4HB | 185 | ||
I3L514 | I3L514_HUMAN | P4HB | 463 | ||
I3L4M2 | I3L4M2_HUMAN | P4HB | 537 | ||
I3L3U6 | I3L3U6_HUMAN | P4HB | 128 | ||
I3L3P5 | I3L3P5_HUMAN | P4HB | 472 | ||
I3L1Y5 | I3L1Y5_HUMAN | P4HB | 54 | ||
I3L0S0 | I3L0S0_HUMAN | P4HB | 466 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC145207 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC174470 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |