A0A7M7PRV8 · A0A7M7PRV8_STRPU
- ProteinKinesin light chain
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids576 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Kinesin is a microtubule-associated force-producing protein that play a role in organelle transport.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | kinesin complex | |
Cellular Component | microtubule |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameKinesin light chain
Organism names
- Taxonomic lineageEukaryota > Metazoa > Echinodermata > Eleutherozoa > Echinozoa > Echinoidea > Euechinoidea > Echinacea > Camarodonta > Echinidea > Strongylocentrotidae > Strongylocentrotus
Accessions
- Primary accessionA0A7M7PRV8
Proteomes
Subcellular Location
Interaction
Subunit
Oligomeric complex composed of two heavy chains and two light chains.
Structure
Family & Domains
Features
Showing features for region, coiled coil, repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-23 | Disordered | ||||
Sequence: MSGSKLSTPNNSGGGQGNLSQEQ | ||||||
Coiled coil | 98-153 | |||||
Sequence: LNMVEAEKQKLRAQVRRLVQENTWLRDELAATQQKLQTSEQNLADLEVKYKHLEYM | ||||||
Region | 158-204 | Disordered | ||||
Sequence: KYDEDRTPDEEASSSDPLDLGFPEDDDGGQADESYPQPQTGSGSVSA | ||||||
Repeat | 299-332 | TPR | ||||
Sequence: AATLNNLAVLYGKRGKYKEAEPLCKRALEIREKV | ||||||
Region | 521-576 | Disordered | ||||
Sequence: DLSTDVPRSEAMAKERHHRRSSGTPRHGSTESVSYEKTDGSEEVSIGVAWKAHEKS |
Sequence similarities
Belongs to the kinesin light chain family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length576
- Mass (Da)64,549
- Last updated2021-04-07 v1
- Checksum08984EC1F1D47B72
Computationally mapped potential isoform sequences
There are 12 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q05090 | KLC_STRPU | 686 | |||
A0A7M7T5H3 | A0A7M7T5H3_STRPU | 678 | |||
A0A7M7T4W8 | A0A7M7T4W8_STRPU | 691 | |||
A0A7M7PRB3 | A0A7M7PRB3_STRPU | 676 | |||
A0A7M7PRF1 | A0A7M7PRF1_STRPU | 672 | |||
A0A7M7PPL7 | A0A7M7PPL7_STRPU | 663 | |||
A0A7M7PTH0 | A0A7M7PTH0_STRPU | 666 | |||
A0A7M7PTB3 | A0A7M7PTB3_STRPU | 567 | |||
A0A7M7PT11 | A0A7M7PT11_STRPU | 565 | |||
A0A7M7PSA8 | A0A7M7PSA8_STRPU | 604 | |||
A0A7M7PMZ9 | A0A7M7PMZ9_STRPU | 620 | |||
A0A7M7PNM2 | A0A7M7PNM2_STRPU | 700 |
Keywords
- Technical term