A0A7M3V806 · A0A7M3V806_9MUSC
- ProteinNADH-ubiquinone oxidoreductase chain 2
- GeneND2
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids331 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. Essential for the catalytic activity and assembly of complex I.
Catalytic activity
- a ubiquinone + NADH + 5 H+(in) = a ubiquinol + NAD+ + 4 H+(out)
a ubiquinone RHEA-COMP:9565 + CHEBI:57945 + 5 H+ (in)CHEBI:15378= a ubiquinol RHEA-COMP:9566 + CHEBI:57540 + 4 H+ (out)CHEBI:15378
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial inner membrane | |
Molecular Function | NADH dehydrogenase (ubiquinone) activity | |
Biological Process | mitochondrial electron transport, NADH to ubiquinone |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameNADH-ubiquinone oxidoreductase chain 2
- EC number
Gene names
Encoded on
- Mitochondrion
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Oestroidea > Calliphoridae > Calliphorinae > Calliphora
Accessions
- Primary accessionA0A7M3V806
Subcellular Location
UniProt Annotation
GO Annotation
Mitochondrion inner membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 12-33 | Helical | ||||
Sequence: LISISANSWLGAWMGLEINLLA | ||||||
Transmembrane | 53-73 | Helical | ||||
Sequence: FLTQALASSVFLFAVILFLLN | ||||||
Transmembrane | 85-105 | Helical | ||||
Sequence: MMIFSSLLLKSGSAPFHFWFP | ||||||
Transmembrane | 125-152 | Helical | ||||
Sequence: IAPLMLISYIIFKPLIMTSIILSSLIGA | ||||||
Transmembrane | 187-208 | Helical | ||||
Sequence: WLTYFMFYSFLTFAMIFMFNMF | ||||||
Transmembrane | 228-250 | Helical | ||||
Sequence: FFLFFNLLSLGGLPPFLGFFPKW | ||||||
Transmembrane | 262-280 | Helical | ||||
Sequence: LFLLTFMVLMTLITLYFYM | ||||||
Transmembrane | 309-330 | Helical | ||||
Sequence: IFMIFSFFSSFGLFLISSLYFL |
Keywords
- Cellular component
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 17-275 | NADH:quinone oxidoreductase/Mrp antiporter membrane subunit | ||||
Sequence: ANSWLGAWMGLEINLLAFIPLMSDNKLMSTEASLKYFLTQALASSVFLFAVILFLLNSSKTNSNYFMEMMIFSSLLLKSGSAPFHFWFPNVMEGLSWSNALILMTWQKIAPLMLISYIIFKPLIMTSIILSSLIGALGGLNQTSLRKLMAYSSINHLGWMLAAMYNSNLLWLTYFMFYSFLTFAMIFMFNMFKTSHVNQLFSLFFHSKIMKFFLFFNLLSLGGLPPFLGFFPKWIVIQSLTINNQLFLLTFMVLMTLIT | ||||||
Domain | 276-327 | NADH dehydrogenase subunit 2 C-terminal | ||||
Sequence: LYFYMRLSYSAFMLNYYENNWLNSSIYKSINMKIFMIFSFFSSFGLFLISSL |
Sequence similarities
Belongs to the complex I subunit 2 family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length331
- Mass (Da)38,455
- Last updated2021-04-07 v1
- ChecksumD6E4D069F18A6CCE