A0A7L3CQC5 · A0A7L3CQC5_PLUSO
- ProteinGlucosylceramidase
- GeneGba_3
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids165 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
Catalytic activity
- 1-(beta-D-galactosyl)-N-dodecanoylsphing-4-enine + cholesterol = cholesteryl 3-beta-D-galactoside + N-dodecanoylsphing-4-enineThis reaction proceeds in the forward and the backward directions.
- a beta-D-galactosyl-(1<->1')-N-acylsphing-4-enine + cholesterol = an N-acylsphing-4-enine + cholesteryl 3-beta-D-galactosideThis reaction proceeds in the forward and the backward directions.
- a beta-D-glucosyl-(1<->1')-N-acylsphing-4-enine + cholesterol = an N-acylsphing-4-enine + cholesteryl 3-beta-D-glucosideThis reaction proceeds in the forward and the backward directions.
- a beta-D-xylosyl-(1<->1')-N-acylsphing-4-enine + cholesterol = an N-acylsphing-4-enine + cholesteryl 3-beta-D-xylosideThis reaction proceeds in the forward direction.
- beta-D-glucosyl-(1<->1')-N-(15Z-tetracosenoyl)-sphing-4-enine + cholesterol = cholesteryl 3-beta-D-glucoside + N-(15Z-tetracosenoyl)-sphing-4-enineThis reaction proceeds in the forward and the backward directions.
- beta-D-glucosyl-(1<->1)-N-octadecanoylsphing-4-enine + cholesterol = cholesteryl 3-beta-D-glucoside + N-octadecanoylsphing-4-enineThis reaction proceeds in the forward and the backward directions.
- beta-D-glucosyl-N-(9Z-octadecenoyl)-sphing-4E-enine + cholesterol = cholesteryl 3-beta-D-glucoside + N-(9Z-octadecenoyl)-sphing-4-enineThis reaction proceeds in the forward and the backward directions.
- beta-D-glucosyl-N-dodecanoylsphing-4-enine + cholesterol = cholesteryl 3-beta-D-glucoside + N-dodecanoylsphing-4-enineThis reaction proceeds in the forward and the backward directions.
- beta-D-glucosyl-N-octanoylsphing-4E-enine + cholesterol = cholesteryl 3-beta-D-glucoside + N-octanoylsphing-4-enineThis reaction proceeds in the forward and the backward directions.
- beta-D-xylosyl-(1<->1')-N-(9Z-octadecenoyl)-sphing-4-enine + cholesterol = cholesteryl 3-beta-D-xyloside + N-(9Z-octadecenoyl)-sphing-4-enineThis reaction proceeds in the forward direction.
- cholesteryl 3-beta-D-glucoside + H2O = cholesterol + D-glucoseThis reaction proceeds in the forward direction.
Pathway
Steroid metabolism; cholesterol metabolism.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | lysosomal membrane | |
Molecular Function | glucosylceramidase activity | |
Biological Process | cholesterol metabolic process | |
Biological Process | glucosylceramide catabolic process |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameGlucosylceramidase
- EC number
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Archelosauria > Archosauria > Dinosauria > Saurischia > Theropoda > Coelurosauria > Aves > Neognathae > Charadriiformes > Charadriidae > Pluvianellus
Accessions
- Primary accessionA0A7L3CQC5
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Lysosome membrane ; Peripheral membrane protein
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 85-165 | Glycosyl hydrolase family 30 TIM-barrel | ||||
Sequence: VKGFGGSVTDSAAINIQSLSKGAQDNLLRSYFSEEGIEYNLVRVPMASTDFSVRLYTYADAEGDFELKHFNLTEEDTRMKV |
Sequence similarities
Belongs to the glycosyl hydrolase 30 family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusFragment
- Length165
- Mass (Da)18,077
- Last updated2021-04-07 v1
- ChecksumE19501AC67129225
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: L | ||||||
Non-terminal residue | 165 | |||||
Sequence: V |
Keywords
- Technical term