A0A7K6Y0B9 · A0A7K6Y0B9_9PASE
- ProteinP20D1 hydrolase
- GenePm20d1
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids514 (go to sequence)
- Protein existenceInferred from homology
- Annotation score5/5
Function
function
Secreted enzyme that regulates the endogenous N-fatty acyl amino acid (NAAs) tissue and circulating levels by functioning as a bidirectional NAA synthase/hydrolase. It condenses free fatty acids and free amino acids to generate NAAs and bidirectionally catalyzes the reverse hydrolysis reaction. Some of these NAAs stimulate oxidative metabolism via mitochondrial uncoupling, increasing energy expenditure in a UPC1-independent manner. Thereby, this secreted protein may indirectly regulate whole body energy expenditure. PM20D1 circulates in tight association with both low- and high-density (LDL and HDL,respectively) lipoprotein particles.
Catalytic activity
- (5Z,8Z,11Z,14Z)-eicosatetraenoate + L-phenylalanine = N-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-L-phenylalanine + H2OThis reaction proceeds in the forward and the backward directions.
- L-phenylalanine + (9Z)-octadecenoate = N-(9Z-octadecenoyl)-L-phenylalanine + H2OThis reaction proceeds in the forward and the backward directions.
- (9Z)-octadecenoate + glycine = N-(9Z-octadecenoyl)glycine + H2OThis reaction proceeds in the backward direction.
- N-(4Z,7Z,10Z,13Z,16Z,19Z-docosahexaenoyl)-L-phenylalanine + H2O = (4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate + L-phenylalanineThis reaction proceeds in the forward direction.
- N-(5Z,8Z,11Z,14Z)-eicosatetraenoyl-glycine + H2O = (5Z,8Z,11Z,14Z)-eicosatetraenoate + glycineThis reaction proceeds in the forward and the backward directions.
- N-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-L-serine + H2O = (5Z,8Z,11Z,14Z)-eicosatetraenoate + L-serineThis reaction proceeds in the forward and the backward directions.
- N-(9Z-octadecenoyl)-L-asparagine + H2O = L-asparagine + (9Z)-octadecenoateThis reaction proceeds in the forward direction.
- N-(9Z-octadecenoyl)-L-glutamine + H2O = L-glutamine + (9Z)-octadecenoateThis reaction proceeds in the forward direction.
- N-(9Z-octadecenoyl)-L-leucine + H2O = L-leucine + (9Z)-octadecenoateThis reaction proceeds in the forward and the backward directions.
- N-(9Z-octadecenoyl)-L-lysine + H2O = L-lysine + (9Z)-octadecenoateThis reaction proceeds in the forward direction.
- N-(9Z-octadecenoyl)-L-methionine + H2O = (9Z)-octadecenoate + L-methionineThis reaction proceeds in the forward direction.
- N-(9Z-octadecenoyl)-L-serine + H2O = L-serine + (9Z)-octadecenoateThis reaction proceeds in the forward direction.
- N-(9Z-octadecenoyl)-L-tryptophan + H2O = L-tryptophan + (9Z)-octadecenoateThis reaction proceeds in the forward direction.
- N-(9Z-octadecenoyl)-L-tyrosine + H2O = L-tyrosine + (9Z)-octadecenoateThis reaction proceeds in the forward direction.
- N-hexadecanoyl-L-phenylalanine + H2O = hexadecanoate + L-phenylalanineThis reaction proceeds in the forward direction.
- N-octadecanoyl-L-phenylalanine + H2O = octadecanoate + L-phenylalanineThis reaction proceeds in the forward direction.
Pathway
Amino-acid metabolism.
Lipid metabolism; fatty acid metabolism.
GO annotations
Aspect | Term | |
---|---|---|
Molecular Function | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides | |
Molecular Function | metal ion binding | |
Molecular Function | peptidase activity | |
Biological Process | amide biosynthetic process | |
Biological Process | amide catabolic process | |
Biological Process | amino acid metabolic process | |
Biological Process | cellular lipid metabolic process | |
Biological Process | proteolysis |
Keywords
- Molecular function
- Ligand
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Archelosauria > Archosauria > Dinosauria > Saurischia > Theropoda > Coelurosauria > Aves > Neognathae > Neoaves > Telluraves > Australaves > Passeriformes > Passeroidea > Nectariniidae > Promerops
Accessions
- Primary accessionA0A7K6Y0B9
Proteomes
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 250-393 | Peptidase M20 dimerisation | ||||
Sequence: TEKGSMTLNFTVEKEPGHSSFPPKETSIGILAAAMSRLEQNPLRNLFGYGPELMTMEHLASEFKFPLNIIMSNLWLFSPIISRVLAWKPSTNALIRTTTAVTLFNAGIKVNVIPSSARATVNFRIHSAETAAEVLEAVRNTIAD |
Sequence similarities
Belongs to the peptidase M20A family.
Family and domain databases
Sequence
- Sequence statusFragment
- Length514
- Mass (Da)56,393
- Last updated2021-04-07 v1
- Checksum0C1AB7A25C248323
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: M | ||||||
Non-terminal residue | 514 | |||||
Sequence: L |
Keywords
- Technical term