A0A7J8AIE7 · A0A7J8AIE7_MYOMY
- ProteinBardet-Biedl syndrome 4
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids500 (go to sequence)
- Protein existenceInferred from homology
- Annotation score1/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | ciliary basal body | |
Cellular Component | ciliary membrane | |
Biological Process | cilium assembly | |
Biological Process | protein localization to cilium |
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Laurasiatheria > Chiroptera > Yangochiroptera > Vespertilionidae > Myotis
Accessions
- Primary accessionA0A7J8AIE7
Proteomes
Organism-specific databases
Subcellular Location
Structure
Family & Domains
Features
Showing features for region, repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-23 | Disordered | ||||
Sequence: MAEERQPTRTQFPASAESQKPHL | ||||||
Repeat | 168-201 | TPR | ||||
Sequence: DLTYIMLGKIHLLAGDLDKAIEIYKKAVEFSPEN | ||||||
Repeat | 202-235 | TPR | ||||
Sequence: TELLTTLGLLYLQVGIYQKAFEHLGNALTYDPVN | ||||||
Repeat | 304-337 | TPR | ||||
Sequence: WKILYNLGLVHLTMQQYASAFHFLSAAINFQPKM | ||||||
Repeat | 338-371 | TPR | ||||
Sequence: GELYMLLAVALTNLEDTENAKRAYAEAVRLDKYN | ||||||
Region | 439-461 | Disordered | ||||
Sequence: PVKDPKSKQRTTSTSKAASFQQP | ||||||
Region | 481-500 | Disordered | ||||
Sequence: LPSGTQGLDSRALEKGHVVR |
Sequence similarities
Belongs to the BBS4 family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length500
- Mass (Da)56,366
- Last updated2021-04-07 v1
- Checksum155D7774A27E9E48
Computationally mapped potential isoform sequences
There are 10 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A7J8AHX1 | A0A7J8AHX1_MYOMY | mMyoMyo1_001383 | 500 | ||
A0A7J8AIP1 | A0A7J8AIP1_MYOMY | mMyoMyo1_001383 | 350 | ||
A0A7J8AIP8 | A0A7J8AIP8_MYOMY | mMyoMyo1_001383 | 334 | ||
A0A7J8AIL7 | A0A7J8AIL7_MYOMY | mMyoMyo1_001383 | 359 | ||
A0A7J8AJ51 | A0A7J8AJ51_MYOMY | mMyoMyo1_001383 | 328 | ||
A0A7J8AI93 | A0A7J8AI93_MYOMY | mMyoMyo1_001383 | 317 | ||
A0A7J8AHL0 | A0A7J8AHL0_MYOMY | mMyoMyo1_001383 | 314 | ||
A0A7J8AHM0 | A0A7J8AHM0_MYOMY | mMyoMyo1_001383 | 489 | ||
A0A7J8AHT5 | A0A7J8AHT5_MYOMY | mMyoMyo1_001383 | 491 | ||
A0A7J8AI59 | A0A7J8AI59_MYOMY | mMyoMyo1_001383 | 490 |
Keywords
- Technical term