A0A7J7FM02 · A0A7J7FM02_DICBM
- ProteinPeptidase metallopeptidase domain-containing protein
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids588 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
Cofactor
Protein has several cofactor binding sites:
Note: Can bind about 5 Ca2+ ions per subunit.
Note: Binds 2 Zn2+ ions per subunit.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 87 | Zn2+ 2 (UniProtKB | ChEBI); catalytic; in inhibited form | ||||
Sequence: C | ||||||
Binding site | 166 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 176 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 178 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 183 | Ca2+ 3 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 184 | Ca2+ 3 (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 191 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 203 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 205 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 207 | Ca2+ 3 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 208 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 210 | Ca2+ 3 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 210 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 259 | Zn2+ 2 (UniProtKB | ChEBI); catalytic | ||||
Sequence: H | ||||||
Active site | 260 | |||||
Sequence: E | ||||||
Binding site | 263 | Zn2+ 2 (UniProtKB | ChEBI); catalytic | ||||
Sequence: H | ||||||
Binding site | 269 | Zn2+ 2 (UniProtKB | ChEBI); catalytic | ||||
Sequence: H | ||||||
Binding site | 277 | Zn2+ 2 (UniProtKB | ChEBI); catalytic | ||||
Sequence: M | ||||||
Binding site | 348 | Ca2+ 4 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 350 | Ca2+ 5 (UniProtKB | ChEBI) | ||||
Sequence: I | ||||||
Binding site | 399 | Ca2+ 5 (UniProtKB | ChEBI) | ||||
Sequence: A | ||||||
Binding site | 491 | Ca2+ 4 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 493 | Ca2+ 5 (UniProtKB | ChEBI) | ||||
Sequence: V |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular matrix | |
Cellular Component | extracellular space | |
Molecular Function | metalloendopeptidase activity | |
Molecular Function | zinc ion binding | |
Biological Process | collagen catabolic process | |
Biological Process | extracellular matrix organization | |
Biological Process | proteolysis |
Keywords
- Molecular function
- Ligand
Names & Taxonomy
Protein names
- Recommended namePeptidase metallopeptidase domain-containing protein
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Laurasiatheria > Perissodactyla > Rhinocerotidae > Diceros
Accessions
- Primary accessionA0A7J7FM02
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-18 | |||||
Sequence: MLRLLALLLPLLPPPARA | ||||||
Chain | PRO_5029453492 | 19-588 | Peptidase metallopeptidase domain-containing protein | |||
Sequence: SEPAAQDVSLGVDWLTRYGYLPPPHPAQAQLQSPAKLRDAIKVMQRFAGLPETGLLDRGTVAAMHKPRCSLPDVLGVAGLVKRRRRYALSGSMWKKRTLTWRVQSFPQSSALSQETVRTLMHHALTAWGVESGLRFREVGSQGPSEPDILIDFARAYHQDSYPFDGQGGTLAHAFFPGEHSISGDTHFDDEETWTFGSKAGPTPSCLAAPFLVWGWGTQLQPTLAPFPDGEGTDLFAVAVHEFGHALGLGHSSAPDSIMRPFYQGPVGNPAEYRLSQDDREGLQQLYGKAPQPPYDTPTRKPLAPPPPPPALPPDSPSLPGPDRCEGNFDAIANIRGETFFFKGPWFWRLQPSGQLVSPRPARLHRFWEGLPAQVQVIQAAYARHPDGRILLFSGPQFWVFQDRQLEGAARPLSDLGLPPGEAVDAVFSWPLNGKTYLIRGRRYWRYDEAAARPDPGYPRDLSLWEGAPLAPDDVTVSNTGDTYFFKGAHYWRFPKGSVQAEPDSPQPMGPKWLDCPAPSAGPRAPRTPKATLKPGPCDCQCEINQATGRGSVSLLLPLLSLLVGGVTSR |
Keywords
- PTM
Structure
Family & Domains
Features
Showing features for motif, domain, region, compositional bias, repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 85-92 | Cysteine switch | ||||
Sequence: PRCSLPDV | ||||||
Domain | 108-307 | Peptidase metallopeptidase | ||||
Sequence: SGSMWKKRTLTWRVQSFPQSSALSQETVRTLMHHALTAWGVESGLRFREVGSQGPSEPDILIDFARAYHQDSYPFDGQGGTLAHAFFPGEHSISGDTHFDDEETWTFGSKAGPTPSCLAAPFLVWGWGTQLQPTLAPFPDGEGTDLFAVAVHEFGHALGLGHSSAPDSIMRPFYQGPVGNPAEYRLSQDDREGLQQLYGK | ||||||
Region | 304-342 | Disordered | ||||
Sequence: LYGKAPQPPYDTPTRKPLAPPPPPPALPPDSPSLPGPDR | ||||||
Compositional bias | 313-338 | Pro residues | ||||
Sequence: YDTPTRKPLAPPPPPPALPPDSPSLP | ||||||
Repeat | 340-389 | Hemopexin | ||||
Sequence: PDRCEGNFDAIANIRGETFFFKGPWFWRLQPSGQLVSPRPARLHRFWEGL | ||||||
Repeat | 393-438 | Hemopexin | ||||
Sequence: VQVIQAAYARHPDGRILLFSGPQFWVFQDRQLEGAARPLSDLGLPP | ||||||
Repeat | 439-487 | Hemopexin | ||||
Sequence: GEAVDAVFSWPLNGKTYLIRGRRYWRYDEAAARPDPGYPRDLSLWEGAP | ||||||
Repeat | 488-534 | Hemopexin | ||||
Sequence: LAPDDVTVSNTGDTYFFKGAHYWRFPKGSVQAEPDSPQPMGPKWLDC |
Sequence similarities
Belongs to the peptidase M10A family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length588
- Mass (Da)64,445
- Last updated2021-04-07 v1
- Checksum5A3C88A47CEE17F0
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 313-338 | Pro residues | ||||
Sequence: YDTPTRKPLAPPPPPPALPPDSPSLP |
Keywords
- Technical term