A0A7I2V5I6 · A0A7I2V5I6_HUMAN
- ProteinTelomeric repeat-binding factor
- GeneTERF1
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids389 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Binds the telomeric double-stranded 5'-TTAGGG-3' repeat.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chromosome, telomeric region | |
Cellular Component | fibrillar center | |
Cellular Component | nuclear body | |
Molecular Function | double-stranded telomeric DNA binding | |
Molecular Function | protein homodimerization activity | |
Biological Process | telomere maintenance |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameTelomeric repeat-binding factor
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionA0A7I2V5I6
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 380 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
PTM/Processing
Features
Showing features for modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Modified residue (large scale data) | 6 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 7 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 11 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 385 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 387 | PRIDE | Phosphoserine | ||||
Sequence: S |
Proteomic databases
Expression
Gene expression databases
Interaction
Subunit
Homodimer.
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-36 | Disordered | ||||
Sequence: MAEDVSSAAPSPRGCADGRDADPTEEQMAETERNDE | ||||||
Compositional bias | 18-36 | Basic and acidic residues | ||||
Sequence: GRDADPTEEQMAETERNDE | ||||||
Region | 213-261 | Disordered | ||||
Sequence: VVESKRTRTITSQDKPSGNDVEMETEANLDTRKSVSDKQSAVTESSEGT | ||||||
Compositional bias | 231-245 | Basic and acidic residues | ||||
Sequence: NDVEMETEANLDTRK | ||||||
Compositional bias | 246-261 | Polar residues | ||||
Sequence: SVSDKQSAVTESSEGT | ||||||
Region | 276-325 | Disordered | ||||
Sequence: LQHGTQQQDLNKKERRVGTPQSTKKKKESRRATESRIPVSKSQPVTPEKH | ||||||
Compositional bias | 282-310 | Basic and acidic residues | ||||
Sequence: QQDLNKKERRVGTPQSTKKKKESRRATES | ||||||
Domain | 325-378 | Myb-like | ||||
Sequence: HRARKRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRWRTMK | ||||||
Domain | 325-382 | HTH myb-type | ||||
Sequence: HRARKRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRWRTMKKLKL |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length389
- Mass (Da)44,195
- Last updated2021-04-07 v1
- Checksum4A7C6AE676E6651E
Computationally mapped potential isoform sequences
There are 7 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
P54274 | TERF1_HUMAN | TERF1 | 439 | ||
E7EWM7 | E7EWM7_HUMAN | TERF1 | 369 | ||
A0A7I2YQE7 | A0A7I2YQE7_HUMAN | TERF1 | 449 | ||
E5RFJ5 | E5RFJ5_HUMAN | TERF1 | 263 | ||
A0A7I2V3N9 | A0A7I2V3N9_HUMAN | TERF1 | 107 | ||
A0A7I2V5E0 | A0A7I2V5E0_HUMAN | TERF1 | 312 | ||
A0A7I2V5T5 | A0A7I2V5T5_HUMAN | TERF1 | 391 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 18-36 | Basic and acidic residues | ||||
Sequence: GRDADPTEEQMAETERNDE | ||||||
Compositional bias | 231-245 | Basic and acidic residues | ||||
Sequence: NDVEMETEANLDTRK | ||||||
Compositional bias | 246-261 | Polar residues | ||||
Sequence: SVSDKQSAVTESSEGT | ||||||
Compositional bias | 282-310 | Basic and acidic residues | ||||
Sequence: QQDLNKKERRVGTPQSTKKKKESRRATES |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC022893 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |