A0A7I2V2C5 · A0A7I2V2C5_HUMAN
- ProteinExportin 1
- GeneXPO1
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids115 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score1/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | nuclear export signal receptor activity | |
Molecular Function | small GTPase binding | |
Biological Process | protein export from nucleus |
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Taxonomic lineagecellular organisms > Eukaryota (eucaryotes) > Opisthokonta > Metazoa (metazoans) > Eumetazoa > Bilateria > Deuterostomia > Chordata (chordates) > Craniata > Vertebrata (vertebrates) > Gnathostomata (jawed vertebrates) > Teleostomi > Euteleostomi (bony vertebrates) > Sarcopterygii > Dipnotetrapodomorpha > Tetrapoda (tetrapods) > Amniota (amniotes) > Mammalia (mammals) > Theria > Eutheria (placentals) > Boreoeutheria > Euarchontoglires > Primates > Haplorrhini > Simiiformes > Catarrhini > Hominoidea (apes) > Hominidae (great apes) > Homininae > Homo
Accessions
- Primary accessionA0A7I2V2C5
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 118 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
PTM/Processing
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 46-98 | Importin N-terminal | ||||
Sequence: AQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQ |
Sequence similarities
Belongs to the exportin family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length115
- Mass (Da)13,183
- Last updated2021-04-07 v1
- Checksum1AFACECE770D3204
Computationally mapped potential isoform sequences
There are 22 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
O14980 | XPO1_HUMAN | XPO1 | 1071 | ||
C9IYM2 | C9IYM2_HUMAN | XPO1 | 62 | ||
C9J673 | C9J673_HUMAN | XPO1 | 132 | ||
F8WF71 | F8WF71_HUMAN | XPO1 | 82 | ||
C9JKM9 | C9JKM9_HUMAN | XPO1 | 451 | ||
A0A7P0Z4B7 | A0A7P0Z4B7_HUMAN | XPO1 | 136 | ||
A0A7I2YQP1 | A0A7I2YQP1_HUMAN | XPO1 | 115 | ||
A0A7I2YQV4 | A0A7I2YQV4_HUMAN | XPO1 | 1007 | ||
A0A7I2YQX3 | A0A7I2YQX3_HUMAN | XPO1 | 677 | ||
A0A7I2V6B9 | A0A7I2V6B9_HUMAN | XPO1 | 940 | ||
A0A7I2V2H0 | A0A7I2V2H0_HUMAN | XPO1 | 979 | ||
A0A7I2V2Y6 | A0A7I2V2Y6_HUMAN | XPO1 | 1026 | ||
A0A7I2V396 | A0A7I2V396_HUMAN | XPO1 | 55 | ||
A0A7I2V2S3 | A0A7I2V2S3_HUMAN | XPO1 | 952 | ||
A0A7I2V3J1 | A0A7I2V3J1_HUMAN | XPO1 | 115 | ||
A0A7I2V3N0 | A0A7I2V3N0_HUMAN | XPO1 | 735 | ||
A0A7I2V3P3 | A0A7I2V3P3_HUMAN | XPO1 | 941 | ||
A0A7I2V461 | A0A7I2V461_HUMAN | XPO1 | 1056 | ||
A0A7I2V3W6 | A0A7I2V3W6_HUMAN | XPO1 | 999 | ||
A0A7I2V488 | A0A7I2V488_HUMAN | XPO1 | 904 | ||
A0A7I2V4A3 | A0A7I2V4A3_HUMAN | XPO1 | 688 | ||
A0A7I2V531 | A0A7I2V531_HUMAN | XPO1 | 65 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC016727 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |