A0A7H8QHG6 · A0A7H8QHG6_TALRU
- ProteinUrease
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids1142 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
Catalytic activity
- 2 H+ + H2O + urea = CO2 + 2 NH4+
Cofactor
Note: Binds 2 nickel ions per subunit.
Pathway
Nitrogen metabolism; urea degradation; CO2 and NH3 from urea (urease route): step 1/1.
Features
Showing features for dna binding, binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 117-186 | HMG box | ||||
Sequence: PKRALTPYFLYMQHNRSQIASELGPQAKPKEVSDEGTKRWAEMPEEDKAVWKKLYADNLAVYKAKMTAYK | ||||||
Binding site | 711 | Ni2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 713 | Ni2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 794 | Ni2+ 1 (UniProtKB | ChEBI); via carbamate group | ||||
Sequence: K | ||||||
Binding site | 794 | Ni2+ 2 (UniProtKB | ChEBI); via carbamate group | ||||
Sequence: K | ||||||
Binding site | 796 | substrate | ||||
Sequence: H | ||||||
Binding site | 823 | Ni2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 849 | Ni2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Active site | 897 | Proton donor | ||||
Sequence: H | ||||||
Binding site | 937 | Ni2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Cellular Component | urease complex | |
Molecular Function | DNA binding | |
Molecular Function | nickel cation binding | |
Molecular Function | urease activity | |
Biological Process | urea catabolic process |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameUrease
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Pezizomycotina > Eurotiomycetes > Eurotiomycetidae > Eurotiales > Trichocomaceae > Talaromyces > Talaromyces sect. Islandici
Accessions
- Primary accessionA0A7H8QHG6
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
PTM/Processing
Features
Showing features for modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Modified residue | 794 | N6-carboxylysine | ||||
Sequence: K |
Post-translational modification
Carbamylation allows a single lysine to coordinate two nickel ions.
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 84-120 | Disordered | ||||
Sequence: GAGLPRHSSPPEATKPEVGDKKKRKRAPPDPNAPKRA | ||||||
Compositional bias | 96-114 | Basic and acidic residues | ||||
Sequence: ATKPEVGDKKKRKRAPPDP | ||||||
Domain | 117-186 | HMG box | ||||
Sequence: PKRALTPYFLYMQHNRSQIASELGPQAKPKEVSDEGTKRWAEMPEEDKAVWKKLYADNLAVYKAKMTAYK | ||||||
Region | 136-156 | Disordered | ||||
Sequence: ASELGPQAKPKEVSDEGTKRW | ||||||
Region | 195-311 | Disordered | ||||
Sequence: DNAKADNQLQQSVAAAEAEAAEDDDSSSSSNEDESSEEPAKEPTPPPSGKRRRVGAKAANNVSTPVSAKKASPEKKKTPAPKKTETKEVKEAKEPASTRKSLGTSADGKPSKKKRKS | ||||||
Compositional bias | 212-226 | Acidic residues | ||||
Sequence: AEAAEDDDSSSSSNE | ||||||
Compositional bias | 228-242 | Basic and acidic residues | ||||
Sequence: ESSEEPAKEPTPPPS | ||||||
Compositional bias | 264-291 | Basic and acidic residues | ||||
Sequence: KASPEKKKTPAPKKTETKEVKEAKEPAS | ||||||
Domain | 706-1142 | Urease | ||||
Sequence: GGFDTHIHFICPQQVNEAISSGITTMLGGGTGPSTGSNATTCTPGPNHMRQMMQACDALPVNIGITGKGNDSGKQSLREQCLAGAAGLKLHEDWGSTPAAIDSCLEVCDEFDVQCLIHTDTLNESGFVEQTIGAFKNRTIHTYHTEGAGGGHAPDIISVVEHSNVLPSSTNPTRPFTLNTLDEHLDMLMVCHHLSKNIPEDVAFAESRIRAETIAAEDVLHDLGAISMMSSDSQAMGRCGEVILRTWNTAHKNKLQRGTLSEDEGTGADNFRVKRYISKYTINPAIAQGMSHLIGSVETGKIADLVLWTPDNFGTKPKMVLKSGMIAVAQMGDPNASIPTVEPIIMRPQFGVLVPSTSIMFVSEASISQGIVQTYNLRKRIEPIKNCRNIGKGDMKYNDIMPRMKVDPERYTVEADGQLCTAEPATSLPLTQQYFVY |
Sequence similarities
In the C-terminal section; belongs to the metallo-dependent hydrolases superfamily. Urease alpha subunit family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,142
- Mass (Da)123,037
- Last updated2021-02-10 v1
- Checksum128E9861ACAB1FCF
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 96-114 | Basic and acidic residues | ||||
Sequence: ATKPEVGDKKKRKRAPPDP | ||||||
Compositional bias | 212-226 | Acidic residues | ||||
Sequence: AEAAEDDDSSSSSNE | ||||||
Compositional bias | 228-242 | Basic and acidic residues | ||||
Sequence: ESSEEPAKEPTPPPS | ||||||
Compositional bias | 264-291 | Basic and acidic residues | ||||
Sequence: KASPEKKKTPAPKKTETKEVKEAKEPAS |
Keywords
- Technical term