A0A7G3KZU1 · A0A7G3KZU1_9VIRU
- ProteinNon-structural polyprotein 1AB
- GeneORF1b
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids516 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Contains the viral protease participating in the cleavage of the polyprotein into functional products. It contains also the activities necessary for replication of genomic RNA, as well as transcription of subgenomic mRNA.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | host cell membrane | |
Molecular Function | nucleotide binding | |
Molecular Function | RNA binding | |
Molecular Function | RNA-dependent RNA polymerase activity | |
Biological Process | DNA-templated transcription | |
Biological Process | viral RNA genome replication | |
Biological Process | viral translational frameshifting |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameNon-structural polyprotein 1AB
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageViruses > Riboviria > Orthornavirae > Pisuviricota > Stelpaviricetes > Stellavirales > Astroviridae > Avastrovirus
Accessions
- Primary accessionA0A7G3KZU1
Subcellular Location
UniProt Annotation
GO Annotation
Host membrane ; Multi-pass membrane protein
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 259-393 | RdRp catalytic | ||||
Sequence: RFFVETDWTRYDGTLPKPLFWRIRQMRYFFLSNHHKTPQLKKLYDWYVKNLVEKIILLPTGEVCTVKKGNPSGQYSTTVDNNMCNVWLTHFEIAYLYWKQHGSLPTLRLLRDNVTMICYGDDRLVSIRKGFINYD |
Sequence similarities
Belongs to the astroviridae polyprotein 1AB family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length516
- Mass (Da)60,397
- Last updated2021-02-10 v1
- ChecksumA72735B34DBED197
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: K |
Keywords
- Coding sequence diversity
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
MN307116 EMBL· GenBank· DDBJ | QEP29126.1 EMBL· GenBank· DDBJ | Genomic RNA | ||
MN307117 EMBL· GenBank· DDBJ | QEP29129.1 EMBL· GenBank· DDBJ | Genomic RNA | ||
MN307119 EMBL· GenBank· DDBJ | QEP29135.1 EMBL· GenBank· DDBJ | Genomic RNA | ||
MN103532 EMBL· GenBank· DDBJ | QNL34472.1 EMBL· GenBank· DDBJ | Genomic RNA | ||
MN127954 EMBL· GenBank· DDBJ | QNS30035.1 EMBL· GenBank· DDBJ | Genomic RNA | ||
MN127956 EMBL· GenBank· DDBJ | QNS30041.1 EMBL· GenBank· DDBJ | Genomic RNA | ||
MN127957 EMBL· GenBank· DDBJ | QNS30044.1 EMBL· GenBank· DDBJ | Genomic RNA | ||
MW413813 EMBL· GenBank· DDBJ | QRN46260.1 EMBL· GenBank· DDBJ | Genomic RNA | ||
MW592378 EMBL· GenBank· DDBJ | QTF19741.1 EMBL· GenBank· DDBJ | Genomic RNA | ||
MW592379 EMBL· GenBank· DDBJ | QTF19744.1 EMBL· GenBank· DDBJ | Genomic RNA |