A0A6P5GW78 · A0A6P5GW78_ANACO
- Proteintuliposide A-converting enzyme
- GeneLOC109725340
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids330 (go to sequence)
- Protein existencePredicted
- Annotation score2/5
Function
function
Lactone-forming carboxylesterases, specifically catalyzing intramolecular transesterification, but not hydrolysis. Involved in the biosynthesis of tulipalins, defensive chemicals that show antimicrobial activities against a broad range of strains of bacteria and fungi. Substrates are 6-tuliposide A > 6-tuliposide B.
Catalytic activity
- 6-tuliposide A = D-glucose + tulipalin A
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 169 | |||||
Sequence: S |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | hydrolase activity |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nametuliposide A-converting enzyme
- EC number
Gene names
Organism names
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Bromeliaceae > Bromelioideae > Ananas
Accessions
- Primary accessionA0A6P5GW78
Proteomes
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 86-307 | Alpha/beta hydrolase fold-3 | ||||
Sequence: LVYFHGGGFVIESAESPTYHSYLNALASRARILVVSVEYRRAPEHPLPAAYDDSWAALRWVAARADPWLAERGDLARVFLAGDSAGGNIAHNVAMRVAAEDLGGDEGARIEGLILAHPWFWGKEPIGEETRDPVRREWTERLWKTVCPGTEGIDDPRINPMAEGEAGLERLGKLPCETVMVAVAEKDMLSERGRAYCEGLKKSGWGGRVELLDIEGEDHVFH |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length330
- Mass (Da)36,314
- Last updated2020-12-02 v1
- Checksum0338A79CC4B8F05F