A0A6M3Z8U0 · A0A6M3Z8U0_BACSU
- ProteinEpoxyqueuosine reductase
- GenequeG
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids386 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Catalyzes the conversion of epoxyqueuosine (oQ) to queuosine (Q), which is a hypermodified base found in the wobble positions of tRNA(Asp), tRNA(Asn), tRNA(His) and tRNA(Tyr).
Catalytic activity
- AH2 + epoxyqueuosine34 in tRNA = A + H2O + queuosine34 in tRNA
Cofactor
Protein has several cofactor binding sites:
Note: Binds 2 [4Fe-4S] clusters per monomer.
Pathway
tRNA modification; tRNA-queuosine biosynthesis.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 57 | cob(II)alamin (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 97 | cob(II)alamin (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Active site | 134 | Proton donor | ||||
Sequence: D | ||||||
Binding site | 134 | cob(II)alamin (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 139-141 | cob(II)alamin (UniProtKB | ChEBI) | ||||
Sequence: SDR | ||||||
Binding site | 152 | cob(II)alamin (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 155 | cob(II)alamin (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 158 | cob(II)alamin (UniProtKB | ChEBI) | ||||
Sequence: I | ||||||
Binding site | 169 | cob(II)alamin (UniProtKB | ChEBI) | ||||
Sequence: L | ||||||
Binding site | 188 | [4Fe-4S] cluster 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 191 | [4Fe-4S] cluster 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 194 | [4Fe-4S] cluster 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 198 | [4Fe-4S] cluster 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 214 | [4Fe-4S] cluster 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 216 | cob(II)alamin (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 220 | tRNA (UniProtKB | ChEBI) | ||||
Sequence: Q | ||||||
Binding site | 222 | tRNA (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 240 | [4Fe-4S] cluster 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 240-241 | cob(II)alamin (UniProtKB | ChEBI) | ||||
Sequence: CD | ||||||
Binding site | 243 | [4Fe-4S] cluster 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 247 | [4Fe-4S] cluster 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 280 | tRNA (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 281 | tRNA (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 295 | tRNA (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 297 | tRNA (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 298 | tRNA (UniProtKB | ChEBI) | ||||
Sequence: K |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | 4 iron, 4 sulfur cluster binding | |
Molecular Function | cobalamin binding | |
Molecular Function | epoxyqueuosine reductase activity | |
Molecular Function | metal ion binding | |
Biological Process | queuosine biosynthetic process | |
Biological Process | tRNA modification |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameEpoxyqueuosine reductase
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageBacteria > Bacillota > Bacilli > Bacillales > Bacillaceae > Bacillus
Accessions
- Primary accessionA0A6M3Z8U0
Subcellular Location
Interaction
Subunit
Monomer.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 178-208 | 4Fe-4S ferredoxin-type | ||||
Sequence: FEPDVPIEDMCGSCTKCLDACPTGALVNPGQ |
Sequence similarities
Belongs to the QueG family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length386
- Mass (Da)43,142
- Last updated2020-10-07 v1
- Checksum56E5477D0D01CB30
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CP052842 EMBL· GenBank· DDBJ | QJP87415.1 EMBL· GenBank· DDBJ | Genomic DNA |