A0A6M3TQ84 · A0A6M3TQ84_9LILI
- ProteinNAD(P)H-quinone oxidoreductase subunit I, chloroplastic
- GenendhI
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids179 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.
Catalytic activity
- a plastoquinone + NADH + (n+1) H+(in) = a plastoquinol + NAD+ + n H+(out)
a plastoquinone RHEA-COMP:9562 + CHEBI:57945 + (n+1) H+ (in)CHEBI:15378= a plastoquinol RHEA-COMP:9561 + CHEBI:57540 + n H+ (out)CHEBI:15378 - a plastoquinone + NADPH + (n+1) H+(in) = a plastoquinol + NADP+ + n H+(out)
Cofactor
Note: Binds 2 [4Fe-4S] clusters per subunit.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 64 | [4Fe-4S] cluster 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 67 | [4Fe-4S] cluster 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 70 | [4Fe-4S] cluster 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 74 | [4Fe-4S] cluster 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 104 | [4Fe-4S] cluster 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 107 | [4Fe-4S] cluster 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 110 | [4Fe-4S] cluster 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 114 | [4Fe-4S] cluster 1 (UniProtKB | ChEBI) | ||||
Sequence: C |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast thylakoid membrane | |
Molecular Function | 4 iron, 4 sulfur cluster binding | |
Molecular Function | iron ion binding | |
Molecular Function | NADH dehydrogenase (ubiquinone) activity | |
Molecular Function | quinone binding | |
Biological Process | photosynthesis, light reaction |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameNAD(P)H-quinone oxidoreductase subunit I, chloroplastic
- EC number
- Alternative names
Gene names
Encoded on
- Chloroplast
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Liliales > Liliaceae > Fritillaria
Accessions
- Primary accessionA0A6M3TQ84
Subcellular Location
UniProt Annotation
GO Annotation
Plastid, chloroplast thylakoid membrane ; Peripheral membrane protein
Keywords
- Cellular component
PTM/Processing
Keywords
- PTM
Interaction
Subunit
NDH is composed of at least 16 different subunits, 5 of which are encoded in the nucleus.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 55-84 | 4Fe-4S ferredoxin-type | ||||
Sequence: GRIHFEFDKCIACEVCVRVCPIDLPVVDWR | ||||||
Domain | 95-124 | 4Fe-4S ferredoxin-type | ||||
Sequence: LNYSIDFGVCIFCGNCIEYCPTNCLSMTEE |
Sequence similarities
Belongs to the complex I 23 kDa subunit family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length179
- Mass (Da)20,721
- Last updated2020-10-07 v1
- Checksum1457249A941BBC42
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
MH593353 EMBL· GenBank· DDBJ | QJE34996.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MH593354 EMBL· GenBank· DDBJ | QJE35080.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MH593355 EMBL· GenBank· DDBJ | QJE35164.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MN480806 EMBL· GenBank· DDBJ | QRC17372.1 EMBL· GenBank· DDBJ | Genomic DNA |