A0A6J1DEY2 · A0A6J1DEY2_MOMCH
- ProteinBis(5'-adenosyl)-triphosphatase
- GeneLOC111020419
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids156 (go to sequence)
- Protein existencePredicted
- Annotation score2/5
Function
Catalytic activity
- P1,P3-bis(5'-adenosyl) triphosphate + H2O = AMP + ADP + 2 H+
Cofactor
Features
Showing features for binding site, active site, site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 11 | substrate | ||||
Sequence: H | ||||||
Binding site | 30 | substrate | ||||
Sequence: N | ||||||
Binding site | 85 | substrate | ||||
Sequence: Q | ||||||
Binding site | 91-94 | substrate | ||||
Sequence: GQTV | ||||||
Active site | 98 | Tele-AMP-histidine intermediate | ||||
Sequence: H | ||||||
Binding site | 100 | substrate | ||||
Sequence: H | ||||||
Site | 116 | Important for induction of apoptosis | ||||
Sequence: Y |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | adenylylsulfatase activity | |
Molecular Function | bis(5'-adenosyl)-triphosphatase activity | |
Molecular Function | nucleotide binding |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameBis(5'-adenosyl)-triphosphatase
- EC number
Gene names
Organism names
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > fabids > Cucurbitales > Cucurbitaceae > Momordiceae > Momordica
Accessions
- Primary accessionA0A6J1DEY2
Proteomes
Structure
Family & Domains
Features
Showing features for domain, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 4-111 | HIT | ||||
Sequence: EYYTFGPHKIHRKLIFYTTNLSYAMVNLRPVVPDVLAIPKREVKRFVDLSRDEICDLWLTTQLIGGKLELFHNASSLTLNIQDGPEAGQTVPHVHIHVIPRKAQDFER | ||||||
Motif | 96-100 | Histidine triad motif | ||||
Sequence: HVHIH |
Family and domain databases
Sequence
- Sequence statusComplete
- Length156
- Mass (Da)18,412
- Last updated2020-10-07 v1
- ChecksumFFEB776E7B233FED
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A6J1DIT4 | A0A6J1DIT4_MOMCH | LOC111020419 | 160 |
Keywords
- Technical term