A0A6J0T0A8 · A0A6J0T0A8_9SAUR
- ProteinE3 ubiquitin-protein ligase CHFR
- GeneRNF8
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids501 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
Catalytic activity
Pathway
Protein modification; protein ubiquitination.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | nucleus | |
Cellular Component | site of double-strand break | |
Cellular Component | ubiquitin ligase complex | |
Molecular Function | chromatin binding | |
Molecular Function | histone binding | |
Molecular Function | metal ion binding | |
Molecular Function | ubiquitin binding | |
Molecular Function | ubiquitin protein ligase activity | |
Biological Process | chromatin organization | |
Biological Process | double-strand break repair | |
Biological Process | positive regulation of DNA repair | |
Biological Process | protein K48-linked ubiquitination | |
Biological Process | response to ionizing radiation | |
Biological Process | ubiquitin-dependent protein catabolic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameE3 ubiquitin-protein ligase CHFR
- EC number
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Lepidosauria > Squamata > Bifurcata > Unidentata > Episquamata > Toxicofera > Iguania > Acrodonta > Agamidae > Amphibolurinae > Pogona
Accessions
- Primary accessionA0A6J0T0A8
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 42-96 | FHA | ||||
Sequence: VTIGRGAGVTYQLMSKSCPLMISRNHCVFKQNTDGQWTVTDNKSLNGVWLNCERI | ||||||
Region | 144-223 | Disordered | ||||
Sequence: NDQLTEQTKDMRAKRKISLEESEASGAEGPSNFRSKRDRVSSDNGSLAKSEGGRTELSKQPVENMDIVLLPPKPSKKEKK | ||||||
Compositional bias | 148-165 | Basic and acidic residues | ||||
Sequence: TEQTKDMRAKRKISLEES | ||||||
Coiled coil | 255-307 | |||||
Sequence: LEQIMKTLADMTKLKTKMQEKQTAVLNVRQKNKKCAPKEIQVLEQELQDLQDQ | ||||||
Coiled coil | 357-405 | |||||
Sequence: MEELSRSKKDFEEIIKAKDRELKETKEEKEKARAQKEEALSQMNDVLEN | ||||||
Domain | 409-447 | RING-type | ||||
Sequence: CTICSEHFIEAVTLNCAHSFCSYCISEWMKRRLECPICR |
Sequence similarities
Belongs to the CHFR family.
Belongs to the RNF8 family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length501
- Mass (Da)57,412
- Last updated2020-10-07 v1
- Checksum478B3C8F72A2DDA3
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A6J0SWH9 | A0A6J0SWH9_9SAUR | RNF8 | 553 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 148-165 | Basic and acidic residues | ||||
Sequence: TEQTKDMRAKRKISLEES |
Keywords
- Technical term