A0A6G6A6L5 · A0A6G6A6L5_9CAEN
- ProteinCytochrome c oxidase subunit 2
- GeneCOX2
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids228 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Catalytic activity
- 4 Fe(II)-[cytochrome c] + 8 H+(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H+(out) + 2 H2OThis reaction proceeds in the forward direction.
4 RHEA-COMP:10350 + 8 H+ (in)CHEBI:15378+ CHEBI:15379 = 4 RHEA-COMP:14399 + 4 H+ (out)CHEBI:15378+ 2 CHEBI:15377
Cofactor
Note: Binds a copper A center.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial inner membrane | |
Cellular Component | respirasome | |
Molecular Function | copper ion binding | |
Molecular Function | cytochrome-c oxidase activity | |
Biological Process | ATP synthesis coupled electron transport |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameCytochrome c oxidase subunit 2
Gene names
Encoded on
- Mitochondrion
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Spiralia > Lophotrochozoa > Mollusca > Gastropoda > Caenogastropoda > Neogastropoda > Muricoidea > Muricidae > Ceratostoma
Accessions
- Primary accessionA0A6G6A6L5
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Multi-pass membrane protein
Mitochondrion inner membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 20-43 | Helical | ||||
Sequence: LIFFHDHAMMILVMIISLVGYAAL | ||||||
Transmembrane | 64-87 | Helical | ||||
Sequence: IWTIIPAVILVFLALPSLRLLYLL |
Keywords
- Cellular component
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-91 | Cytochrome oxidase subunit II transmembrane region profile | ||||
Sequence: MSLWGQLGFQDAAAPLMEELIFFHDHAMMILVMIISLVGYAALSLMMNNYTCRSLVEGQEIETIWTIIPAVILVFLALPSLRLLYLLDEVG | ||||||
Domain | 92-225 | Cytochrome oxidase subunit II copper A binding | ||||
Sequence: NCNLSVKSIGHQWYWSYEYTDFPSIEFDSYMIPTNELEPGDFRLLEVDHRMVLPTQTDIRVLVTSADVIHSWTVPSLGVKVDAVPGRLNQLGFFIKYPGVFYGQCSEICGANHSFMPIVVEAVPLKNFLEWTVS |
Sequence similarities
Belongs to the cytochrome c oxidase subunit 2 family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length228
- Mass (Da)25,789
- Last updated2020-08-12 v1
- ChecksumD5EA0578730FB6A5