A0A6C0NC98 · A0A6C0NC98_9FABA
- ProteinPutative cytochrome c biosynthesis ccmC-like mitochondrial protein
- GeneccmC
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids328 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
May be involved in the export of heme to the mitochondrion for the biogenesis of c-type cytochromes.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial membrane | |
Cellular Component | ribonucleoprotein complex | |
Cellular Component | ribosome | |
Molecular Function | heme binding | |
Molecular Function | heme transmembrane transporter activity | |
Biological Process | cytochrome complex assembly |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended namePutative cytochrome c biosynthesis ccmC-like mitochondrial protein
Gene names
Encoded on
- Mitochondrion
Organism names
- Organism
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > fabids > Fabales > Fabaceae > Papilionoideae > 50 kb inversion clade > genistoids sensu lato > core genistoids > Sophoreae > Ammopiptanthus
Accessions
- Primary accessionA0A6C0NC98
Subcellular Location
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 5-175 | Cytochrome c assembly protein | ||||
Sequence: LLQPSFLMSKTRSYALILIGSRLFLTAMAIHLSLRVAPLDLQQGGNSRILYVHVPAARMSILVYIATAINTFLFLLTKHPLFLRSSGTGTEMGAFFTLFTLVTGGFRGRPMWGTFWVWDARLTSVFISFLIYLGALRFQKLPVEPAPISIRAGPIDIPIIKSSVNWWNTLH | ||||||
Domain | 245-304 | Small ribosomal subunit protein uS7 | ||||
Sequence: SERDVIKLMVDAVENIKPICEVEKVGVAGTIYDVPGIVARDRQRTLAIRWILEAAFKRRI |
Sequence similarities
Belongs to the CcmC/CycZ/HelC family.
Belongs to the universal ribosomal protein uS7 family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length328
- Mass (Da)36,583
- Last updated2020-06-17 v1
- ChecksumC28067F231647042