Essential maintenance is planned to begin on Fri Jan 24 2025. The website may be temporarily unavailable. Please use our fallback: https://wwwdev.ebi.ac.uk/uniprot/front-end/fallback/ in case of any outage.

A0A6B2LAM1 · A0A6B2LAM1_9EUKA

  • Protein
    Phospholipase B1, membrane-associated
  • Status
    UniProtKB unreviewed (TrEMBL)
  • Amino acids
  • Protein existence
    Inferred from homology
  • Annotation score
    5/5

Function

function

Calcium-independent membrane-associated phospholipase that catalyzes complete diacylation of phospholipids by hydrolyzing both sn-1 and sn-2 fatty acyl chains attached to the glycerol backbone (phospholipase B activity). Has dual phospholipase and lysophospholipase activities toward diacylphospholipids. Preferentially cleaves sn-2 ester bonds over sn-1 bonds. Acts as a lipase toward glycerolipid substrates. Hydrolyzes fatty acyl chains of diacylglycerols with preference for the sn-2 position and of triacylglycerols with not positional selectivity. May also hydrolyze long chain retinyl esters such as retinyl palmitate. May contribute to digestion of dietary phospholipids, glycerolipids and retinoids, facilitating lipid absorption at the brush border.

Catalytic activity

  • 1,2,3-tri-(9Z-octadecenoyl)-glycerol + H2O = di-(9Z)-octadecenoylglycerol + (9Z)-octadecenoate + H+
    This reaction proceeds in the forward direction.
  • 1,2-di-(9Z-octadecenoyl)-sn-glycero-3-phosphocholine + H2O = 1-(9Z-octadecenoyl)-sn-glycero-3-phosphocholine + (9Z)-octadecenoate + H+
    This reaction proceeds in the forward direction.
  • 1,2-dihexadecanoyl-sn-glycero-3-phosphocholine + 2 H2O = sn-glycerol 3-phosphocholine + 2 hexadecanoate + 2 H+
    This reaction proceeds in the forward direction.
  • 1,2-dihexadecanoyl-sn-glycero-3-phosphocholine + H2O = 1-hexadecanoyl-sn-glycero-3-phosphocholine + hexadecanoate + H+
    This reaction proceeds in the forward direction.
  • 1,3-di-(9Z-octadecenoyl)-glycerol + H2O = 1-(9Z-octadecenoyl)-glycerol + (9Z)-octadecenoate + H+
    This reaction proceeds in the forward direction.
  • 1,3-dihexadecanoyl-2-(9Z-octadecenoyl)glycerol + H2O = 1,3-dihexadecanoylglycerol + (9Z)-octadecenoate + H+
    This reaction proceeds in the forward direction.
  • 1,3-dihexadecanoyl-2-(9Z-octadecenoyl)glycerol + H2O = 1-hexadecanoyl-2-(9Z-octadecenoyl)-glycerol + hexadecanoate + H+
    This reaction proceeds in the forward direction.
  • 1-(9Z-octadecenoyl)-glycerol + H2O = glycerol + (9Z)-octadecenoate + H+
    This reaction proceeds in the forward direction.
  • 1-O-hexadecyl-2-(9Z)-octadecenoyl-sn-glycero-3-phosphocholine + H2O = 1-O-hexadecyl-sn-glycero-3-phosphocholine + (9Z)-octadecenoate + H+
    This reaction proceeds in the forward direction.
  • 1-hexadecanoyl-2-(9Z)-octadecenoyl-3-octadecanoyl-sn-glycerol + H2O = 1-hexadecanoyl-3-octadecanoyl-sn-glycerol + (9Z)-octadecenoate + H+
    This reaction proceeds in the forward direction.
  • 1-hexadecanoyl-2-(9Z)-octadecenoyl-3-octadecanoyl-sn-glycerol + H2O = 1-hexadecanoyl-2-(9Z-octadecenoyl)-sn-glycerol + octadecanoate + H+
    This reaction proceeds in the forward direction.
  • 1-hexadecanoyl-2-(9Z)-octadecenoyl-3-octadecanoyl-sn-glycerol + H2O = 2-(9Z-octadecenoyl)-3-octadecanoyl-sn-glycerol + hexadecanoate + H+
    This reaction proceeds in the forward direction.
  • 1-hexadecanoyl-2-(9Z,12Z-octadecadienoyl)-sn-glycero-3-phosphocholine + H2O = (9Z,12Z)-octadecadienoate + 1-hexadecanoyl-sn-glycero-3-phosphocholine + H+
    This reaction proceeds in the forward direction.
  • 1-hexadecanoyl-2-(9Z,12Z-octadecadienoyl)-sn-glycero-3-phosphocholine + H2O = 2-(9Z,12Z-octadecadienoyl)-sn-glycero-3-phosphocholine + hexadecanoate + H+
    This reaction proceeds in the forward direction.
  • 1-hexadecanoyl-2-(9Z-octadecenoyl)-sn-glycero-3-phospho-(1'-sn-glycerol) + H2O = 1-hexadecanoyl-sn-glycero-3-phospho-(1'-sn-glycerol) + (9Z)-octadecenoate + H+
    This reaction proceeds in the forward direction.
  • 1-hexadecanoyl-2-(9Z-octadecenoyl)-sn-glycero-3-phosphocholine + H2O = 1-hexadecanoyl-sn-glycero-3-phosphocholine + (9Z)-octadecenoate + H+
    This reaction proceeds in the forward direction.
  • 1-hexadecanoyl-2-(9Z-octadecenoyl)-sn-glycero-3-phosphoethanolamine + H2O = 1-hexadecanoyl-sn-glycero-3-phosphoethanolamine + (9Z)-octadecenoate + H+
    This reaction proceeds in the forward direction.
  • 1-hexadecanoyl-sn-glycero-3-phosphocholine + H2O = sn-glycerol 3-phosphocholine + hexadecanoate + H+
    This reaction proceeds in the forward direction.
  • 1-octadecanoyl-2-(9Z,12Z)-octadecadienoyl-sn-glycerol + H2O = 1-octadecanoyl-sn-glycerol + (9Z,12Z)-octadecadienoate + H+
    This reaction proceeds in the forward direction.
  • 2,3-di-(9Z)-octadecenoyl-sn-glycerol + H2O = 3-(9Z-octadecenoyl)-sn-glycerol + (9Z)-octadecenoate + H+
    This reaction proceeds in the forward direction.
  • 2-(9Z-octadecenoyl)-glycerol + H2O = glycerol + (9Z)-octadecenoate + H+
    This reaction proceeds in the forward direction.
  • a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphocholine + a fatty acid + H+
    This reaction proceeds in the forward direction.
    EC:3.1.1.4 (UniProtKB | ENZYME | Rhea)
  • a 1-acyl-sn-glycero-3-phosphocholine + H2O = sn-glycerol 3-phosphocholine + a fatty acid + H+
    This reaction proceeds in the forward direction.
    EC:3.1.1.5 (UniProtKB | ENZYME | Rhea)
  • a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H+
    This reaction proceeds in the forward direction.
    EC:3.1.1.3 (UniProtKB | ENZYME | Rhea)

GO annotations

AspectTerm
Cellular Componentapical plasma membrane
Molecular Functionlysophospholipase activity
Molecular Functionphospholipase A2 activity
Molecular Functiontriacylglycerol lipase activity
Biological Processphospholipid metabolic process

Keywords

Enzyme and pathway databases

Names & Taxonomy

Protein names

  • Recommended name
    Phospholipase B1, membrane-associated
  • EC number
  • Alternative names
    • Lysophospholipase
    • Phospholipase A2
    • Phospholipase B/lipase
    • Triacylglycerol lipase

Organism names

  • Taxonomic identifier
  • Organism
  • Taxonomic lineage
    Eukaryota > Amoebozoa > Tubulinea > Elardia > Arcellinida > Sphaerothecina > Arcellidae > Arcella

Accessions

  • Primary accession
    A0A6B2LAM1

Subcellular Location

Apical cell membrane
; Single-pass type I membrane protein

Keywords

Family & Domains

Sequence similarities

Belongs to the 'GDSL' lipolytic enzyme family. Phospholipase B1 subfamily.

Keywords

Family and domain databases

Sequence

  • Sequence status
    Fragment
  • Length
    301
  • Mass (Da)
    33,278
  • Last updated
    2020-06-17 v1
  • MD5 Checksum
    9C3BE41C43D5D7884B75228813569DBF
MLPADIDIIMAMGDSLTAGFGADSTHLFNLFVDYRGSSFSVGGAKSIDECSTLANILQVYNRNITGYSTGAGEAEEKAKLNVAVTGSRSRDLLKQVHVLRDRLQAYDMKQWKMLTIFIGSNDLCGSCFDPLNSAEHFVANLELALDAVKMQIPFVFVSVIAPPDISILKLINTTWCSVLHTFECPCFFSPGIGGTHEEYVSKLQNLIDSPKYHDDPLFNVVLQPFFEDITIPLTPDGHPDMTFFAPDCFHFSTKAHSAAGLALWNNLMQKPKHKKTHWTIKGTSYPYPPLTHSQTPSNVPS

Features

Showing features for non-terminal residue.

TypeIDPosition(s)Description
Non-terminal residue301

Sequence databases

Nucleotide SequenceProtein SequenceMolecule TypeStatus
GIBP01004799
EMBL· GenBank· DDBJ
NDV33768.1
EMBL· GenBank· DDBJ
Transcribed RNA

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
Help