A0A674G8K2 · A0A674G8K2_TAEGU
- ProteinSpectrin alpha, non-erythrocytic 1
- GeneSPTAN1
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids2445 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cell junction | |
Cellular Component | cell projection | |
Cellular Component | cortical actin cytoskeleton | |
Cellular Component | plasma membrane | |
Molecular Function | actin filament binding | |
Molecular Function | calcium ion binding | |
Molecular Function | calmodulin binding | |
Biological Process | actin cytoskeleton organization | |
Biological Process | actin filament capping |
Keywords
- Molecular function
- Ligand
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Archelosauria > Archosauria > Dinosauria > Saurischia > Theropoda > Coelurosauria > Aves > Neognathae > Passeriformes > Passeroidea > Estrildidae > Estrildinae > Taeniopygia
Accessions
- Primary accessionA0A674G8K2
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
PTM/Processing
Keywords
- PTM
Structure
Family & Domains
Features
Showing features for coiled coil, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Coiled coil | 290-324 | |||||
Sequence: VQALLRKHEGLERDLAALEDKVKALCAEADRLQQS | ||||||
Coiled coil | 386-416 | |||||
Sequence: ADELANDVAGAEALLDRHQEHKGEIDAHEDS | ||||||
Domain | 967-1026 | SH3 | ||||
Sequence: TGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDP | ||||||
Coiled coil | 1106-1140 | |||||
Sequence: VEVLQKKFDDFQKDLKANESRLKDINKVAKDLESE | ||||||
Coiled coil | 1672-1706 | |||||
Sequence: VNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTS | ||||||
Coiled coil | 2151-2183 | |||||
Sequence: MEALEETWRNLQKIIKERELELQKEQRRQEEND | ||||||
Domain | 2296-2331 | EF-hand | ||||
Sequence: EALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYD | ||||||
Domain | 2339-2374 | EF-hand | ||||
Sequence: EPDPEFESILDTVDPNRDGHVSLQEYMAFMISRETE |
Sequence similarities
Belongs to the spectrin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length2,445
- Mass (Da)281,712
- Last updated2020-06-17 v1
- Checksum9C7CE519D55B536A
Computationally mapped potential isoform sequences
There are 5 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A674G7G4 | A0A674G7G4_TAEGU | SPTAN1 | 2476 | ||
H0Z0R3 | H0Z0R3_TAEGU | SPTAN1 | 2456 | ||
A0A674GJE0 | A0A674GJE0_TAEGU | SPTAN1 | 2471 | ||
A0A674GFG4 | A0A674GFG4_TAEGU | SPTAN1 | 2246 | ||
A0A674HBB1 | A0A674HBB1_TAEGU | SPTAN1 | 2465 |
Keywords
- Technical term