A0A654G0X4 · A0A654G0X4_ARATH
- ProteinPeptidase M1 leukotriene A4 hydrolase/aminopeptidase C-terminal domain-containing protein
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids616 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
Cofactor
Note: Binds 1 zinc ion per subunit.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 128-130 | a peptide (UniProtKB | ChEBI) | ||||
Sequence: QCQ | ||||||
Binding site | 280-285 | a peptide (UniProtKB | ChEBI) | ||||
Sequence: PYGGME | ||||||
Binding site | 309 | Zn2+ (UniProtKB | ChEBI); catalytic | ||||
Sequence: H | ||||||
Active site | 310 | Proton acceptor | ||||
Sequence: E | ||||||
Binding site | 313 | Zn2+ (UniProtKB | ChEBI); catalytic | ||||
Sequence: H | ||||||
Binding site | 332 | Zn2+ (UniProtKB | ChEBI); catalytic | ||||
Sequence: E | ||||||
Active site | 397 | Proton donor | ||||
Sequence: Y | ||||||
Binding site | 566-568 | a peptide (UniProtKB | ChEBI) | ||||
Sequence: RMK |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | metallopeptidase activity | |
Molecular Function | zinc ion binding | |
Biological Process | proteolysis |
Keywords
- Molecular function
- Ligand
Names & Taxonomy
Protein names
- Recommended namePeptidase M1 leukotriene A4 hydrolase/aminopeptidase C-terminal domain-containing protein
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionA0A654G0X4
Proteomes
Subcellular Location
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 473-612 | Peptidase M1 leukotriene A4 hydrolase/aminopeptidase C-terminal | ||||
Sequence: TIYTKIISLAKEFKEGKMPSEDDVAEWNGQEWELYLENLPKSCEPSQVMALDKRYRLAESKDYEVKVSFLQLAVTSKCREYHGEVKKTLKEVGRMKYLRPLFTALAQSGGTEEKQLAKQVFAEARETYHPIAQGVVESIL |
Sequence similarities
Belongs to the peptidase M1 family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length616
- Mass (Da)69,296
- Last updated2020-04-22 v1
- Checksum3094F2C540280523