A0A650CH07 · A0A650CH07_SULOH
- ProteinSignal recognition particle 54 kDa protein
- Genesrp54
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids445 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds to the hydrophobic signal sequence of the ribosome-nascent chain (RNC) as it emerges from the ribosomes. The SRP-RNC complex is then targeted to the cytoplasmic membrane where it interacts with the SRP receptor FtsY.
Catalytic activity
- GTP + H2O = GDP + H+ + phosphate
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | signal recognition particle | |
Molecular Function | 7S RNA binding | |
Molecular Function | ATP hydrolysis activity | |
Molecular Function | GTP binding | |
Molecular Function | GTPase activity | |
Biological Process | SRP-dependent cotranslational protein targeting to membrane |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSignal recognition particle 54 kDa protein
- EC number
- Short namesSRP54
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageArchaea > Thermoproteota > Thermoprotei > Sulfolobales > Sulfolobaceae > Sulfurisphaera
Accessions
- Primary accessionA0A650CH07
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Note: The SRP-RNC complex is targeted to the cytoplasmic membrane.
Keywords
- Cellular component
Interaction
Subunit
Part of the signal recognition particle protein translocation system, which is composed of SRP and FtsY. Archaeal SRP consists of a 7S RNA molecule of 300 nucleotides and two protein subunits: SRP54 and SRP19.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-81 | Signal recognition particle SRP54 helical bundle | ||||
Sequence: MLDNLKDAVRKFLGSSNYDKAVNDFIKELQISLIKSDVNVKLVSNLTQKIKDRLEKEKPPTAIERREWFISIVYDELSKLF | ||||||
Domain | 94-297 | AAA+ ATPase | ||||
Sequence: IPYVIMLVGVQGSGKTTTAGKLALFYKKKGYKVGLVAADVYRPAAYDQLVQIGKQINVPVYGEPNNTDAVGIAKRGVEKFLSEKYDIIIVDTAGRHGYGEEVKLLEEMKNMYSEIKPDEVILVIDASIGQKAYDLASRFHQASPIGSIIVTKMDGTAKGGGALSAVAATGAVIKFIGTGEKLDELEVFNPRRFVSRILGMGDIE | ||||||
Domain | 95-292 | SRP54-type proteins GTP-binding | ||||
Sequence: PYVIMLVGVQGSGKTTTAGKLALFYKKKGYKVGLVAADVYRPAAYDQLVQIGKQINVPVYGEPNNTDAVGIAKRGVEKFLSEKYDIIIVDTAGRHGYGEEVKLLEEMKNMYSEIKPDEVILVIDASIGQKAYDLASRFHQASPIGSIIVTKMDGTAKGGGALSAVAATGAVIKFIGTGEKLDELEVFNPRRFVSRILG |
Domain
Composed of three domains: the N-terminal N domain, which is responsible for interactions with the ribosome, the central G domain, which binds GTP, and the C-terminal M domain, which binds the RNA and the signal sequence of the RNC.
Sequence similarities
Belongs to the GTP-binding SRP family. SRP54 subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length445
- Mass (Da)49,816
- Last updated2020-04-22 v1
- ChecksumB607105D7AD86454
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
JACHFY010000001 EMBL· GenBank· DDBJ | MBB5252508.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP045484 EMBL· GenBank· DDBJ | QGR17046.1 EMBL· GenBank· DDBJ | Genomic DNA |