A0A5C7EQN2 · A0A5C7EQN2_9ACTN
- ProteinGlycerol kinase
- GeneglpK
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids514 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Key enzyme in the regulation of glycerol uptake and metabolism. Catalyzes the phosphorylation of glycerol to yield sn-glycerol 3-phosphate.
Catalytic activity
- glycerol + ATP = sn-glycerol 3-phosphate + ADP + H+
Activity regulation
Inhibited by fructose 1,6-bisphosphate (FBP).
Pathway
Polyol metabolism; glycerol degradation via glycerol kinase pathway; sn-glycerol 3-phosphate from glycerol: step 1/1.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 30 | ADP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 30 | ATP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 30 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 31 | ATP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 32 | ATP (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 34 | ADP (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 100 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 100 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 101 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 101 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 152 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 152 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 261 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 261 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 262 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: Q | ||||||
Binding site | 283 | ADP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 283 | ATP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 326 | ADP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 326 | ATP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 330 | ATP (UniProtKB | ChEBI) | ||||
Sequence: Q | ||||||
Binding site | 427 | ADP (UniProtKB | ChEBI) | ||||
Sequence: A | ||||||
Binding site | 427 | ATP (UniProtKB | ChEBI) | ||||
Sequence: A | ||||||
Binding site | 431 | ADP (UniProtKB | ChEBI) | ||||
Sequence: N |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Molecular Function | ATP binding | |
Molecular Function | glycerol kinase activity | |
Biological Process | glycerol catabolic process | |
Biological Process | glycerol-3-phosphate metabolic process | |
Biological Process | phosphorylation |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameGlycerol kinase
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageBacteria > Actinomycetota > Coriobacteriia > Coriobacteriales > Coriobacteriaceae > Collinsella
Accessions
- Primary accessionA0A5C7EQN2
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 22-268 | Carbohydrate kinase FGGY N-terminal | ||||
Sequence: YIMALDSGTTSVRAIIVDEYDCIVAQASRAITTSYPELGWVEQDPMEILASQIAVMMEVQFKSGIHSDSIAAIGITNQRETTVVWDRDSGQPIYNAIGWQCRRTAPIADKLVHDGLTDVIRSKTGLKPDAYFSATKVKWILDNVAGAREAAEAGQLMFGTIDTWLIYNLTGGMVYATDYTNASRTMLFNIHTLEWDEELLKIFDIPHSMLPEVRWSSGEFGRVSSEIMTHTPPITGVAGDQQASFFG | ||||||
Domain | 279-466 | Carbohydrate kinase FGGY C-terminal | ||||
Sequence: NTYGTGCFMLMNTGDEVVESKNGLVSTIGIAESGRISYALEGSIFHAGSVIQWLRDKLGIIADAGETAAIARSIPNNKGCYLVPAFSGLGAPWWDPDSRGLICGLTAASDRATLVRAACESMAYQTFDVLRAMEMDAGRKLESLSVDGAASRNEFIMQFQADLLGISVVQSESLETTALGAAYLAGLA |
Sequence similarities
Belongs to the FGGY kinase family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length514
- Mass (Da)55,916
- Last updated2019-11-13 v1
- Checksum716642889FAF6AF6
Keywords
- Technical term