A0A5A4LZU6 · A0A5A4LZU6_9ALPC
- ProteinSpike glycoprotein
- GeneS
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids1386 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
S1 region attaches the virion to the cell membrane by interacting with the host receptor, initiating the infection. Binding to the receptor probably induces conformational changes in the S glycoprotein unmasking the fusion peptide of S2 region and activating membranes fusion. S2 region belongs to the class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) regions assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | host cell endoplasmic reticulum-Golgi intermediate compartment membrane | |
Cellular Component | membrane | |
Cellular Component | viral envelope | |
Cellular Component | virion membrane | |
Biological Process | endocytosis involved in viral entry into host cell | |
Biological Process | fusion of virus membrane with host endosome membrane | |
Biological Process | fusion of virus membrane with host plasma membrane | |
Biological Process | receptor-mediated virion attachment to host cell |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameSpike glycoprotein
- Short namesS glycoprotein
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageViruses > Riboviria > Orthornavirae > Pisuviricota > Pisoniviricetes > Nidovirales > Cornidovirineae > Coronaviridae > Orthocoronavirinae > Alphacoronavirus > Pedacovirus
Accessions
- Primary accessionA0A5A4LZU6
Subcellular Location
UniProt Annotation
GO Annotation
Host endoplasmic reticulum-Golgi intermediate compartment membrane ; Single-pass type I membrane protein
Virion membrane ; Single-pass type I membrane protein
Note: Accumulates in the endoplasmic reticulum-Golgi intermediate compartment, where it participates in virus particle assembly.
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 1328-1347 | Helical | ||||
Sequence: WWVWLIIFIVLIFVVSLLVF |
Keywords
- Cellular component
PTM/Processing
Keywords
- PTM
Interaction
Subunit
Homotrimer. During virus morphogenesis, found in a complex with M and HE proteins. Interacts with host receptor.
Structure
Family & Domains
Features
Showing features for region, domain, coiled coil, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 958-978 | Fusion peptide | ||||
Sequence: IGGMVLGGFTSAAALPFSYAV | ||||||
Domain | 972-1091 | Coronavirus spike (S) glycoprotein S2 subunit heptad repeat 1 (HR1) region profile | ||||
Sequence: LPFSYAVQARLNYLALQTDVLQRNQQLLAESFNSAIGNITSAFESVKEAISQTSKGLNTVAHALTKVQEVVNSQGAALTQLTVQLQHNFQAISSSIDDIYSRLDILSADVQVDRLITGRL | ||||||
Coiled coil | 1039-1083 | |||||
Sequence: QEVVNSQGAALTQLTVQLQHNFQAISSSIDDIYSRLDILSADVQV | ||||||
Domain | 1243-1339 | Coronavirus spike (S) glycoprotein S2 subunit heptad repeat 2 (HR2) region profile | ||||
Sequence: PDYIDVNKTLDEILASLPNRTGPSLPLDVFNATYLNLTGEIADLEQRSESLRNTTEELQSLIYNINNTLVDLEWLNRVETYIKWPWWVWLIIFIVLI | ||||||
Coiled coil | 1275-1317 | |||||
Sequence: TYLNLTGEIADLEQRSESLRNTTEELQSLIYNINNTLVDLEWL | ||||||
Motif | 1382-1386 | KxHxx | ||||
Sequence: KVHVQ |
Domain
The KxHxx motif seems to function as an ER retrieval signal.
Sequence similarities
Belongs to the alphacoronaviruses spike protein family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,386
- Mass (Da)151,841
- Last updated2019-11-13 v1
- Checksum721AD6253A26AB1E