A0A510E6L4 · A0A510E6L4_9CREN
- ProteinS-methyl-5'-thioadenosine phosphorylase
- GenemtnP
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids270 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.
Catalytic activity
- phosphate + S-methyl-5'-thioadenosine = adenine + S-methyl-5-thio-alpha-D-ribose 1-phosphate
Pathway
Amino-acid biosynthesis; L-methionine biosynthesis via salvage pathway; S-methyl-5-thio-alpha-D-ribose 1-phosphate from S-methyl-5'-thioadenosine (phosphorylase route): step 1/1.
Features
Showing features for binding site, site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 16 | phosphate (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 58-59 | phosphate (UniProtKB | ChEBI) | ||||
Sequence: RH | ||||||
Binding site | 91-92 | phosphate (UniProtKB | ChEBI) | ||||
Sequence: SA | ||||||
Site | 171 | Important for substrate specificity | ||||
Sequence: S | ||||||
Binding site | 190 | substrate | ||||
Sequence: M | ||||||
Binding site | 191 | phosphate (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 214-216 | substrate | ||||
Sequence: DYD | ||||||
Site | 225 | Important for substrate specificity | ||||
Sequence: A |
GO annotations
Aspect | Term | |
---|---|---|
Molecular Function | S-methyl-5-thioadenosine phosphorylase activity | |
Biological Process | L-methionine salvage from methylthioadenosine | |
Biological Process | purine ribonucleoside salvage |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameS-methyl-5'-thioadenosine phosphorylase
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageArchaea > Thermoproteota > Thermoprotei > Sulfolobales > Sulfolobaceae > Sulfuracidifex
Accessions
- Primary accessionA0A510E6L4
- Secondary accessions
Proteomes
Interaction
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 10-248 | Nucleoside phosphorylase | ||||
Sequence: VAIIGGSGIYDLSYISDVKEIKVYTPYGSPSDLISVGRMGNVKVAFLPRHGKNHRIPPHMINYRANIWALKELGVKWVISVSAVGSLRMDYKPGDFVVPDQFIDMTKKREYTFFDGPVVAHVSMADPFCNSLRKRLIEKGNSLGIVVHGQGTYICIEGPRFSTRAESRVWKDSFKADIIGMTAVPEVNLACEAQMCYATLAMVTDYDVFADIPVTAEEVTQVMKRNTENAKKLVMEVIK |
Sequence similarities
Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length270
- Mass (Da)30,094
- Last updated2019-10-16 v1
- ChecksumA2B2A18DFCEB7C9D
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AP018929 EMBL· GenBank· DDBJ | BBG25391.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP018930 EMBL· GenBank· DDBJ | BBG28185.1 EMBL· GenBank· DDBJ | Genomic DNA |