A0A4X2MBE5 · A0A4X2MBE5_VOMUR
- ProteinFibulin-1
- GeneFBLN1
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids702 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Incorporated into fibronectin-containing matrix fibers. May play a role in cell adhesion and migration along protein fibers within the extracellular matrix (ECM). Could be important for certain developmental processes and contribute to the supramolecular organization of ECM architecture, in particular to those of basement membranes.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | basement membrane | |
Cellular Component | elastic fiber | |
Cellular Component | extracellular space | |
Molecular Function | calcium ion binding | |
Molecular Function | extracellular matrix structural constituent | |
Molecular Function | fibrinogen binding | |
Molecular Function | fibronectin binding | |
Molecular Function | identical protein binding | |
Molecular Function | integrin binding | |
Molecular Function | peptidase activator activity | |
Biological Process | blood coagulation, fibrin clot formation | |
Biological Process | extracellular matrix organization | |
Biological Process | negative regulation of cell motility | |
Biological Process | negative regulation of ERK1 and ERK2 cascade | |
Biological Process | negative regulation of protein phosphorylation | |
Biological Process | negative regulation of stem cell proliferation | |
Biological Process | negative regulation of substrate adhesion-dependent cell spreading |
Names & Taxonomy
Protein names
- Recommended nameFibulin-1
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Metatheria > Diprotodontia > Vombatidae > Vombatus
Accessions
- Primary accessionA0A4X2MBE5
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-25 | |||||
Sequence: MEPAWTPRLLALLALVTLLAARATA | ||||||
Chain | PRO_5021230851 | 26-702 | Fibulin-1 | |||
Sequence: DVLMEDCCADGHRLATQKRDCSVPYASESKECRMVQEQCCQNQLEELHCATGINVAHEGDSCDTHHNNSSFEAKFVKKCCHCCLLGKAAQAQGQSCEYNLMIGYQCGLVYRACCVKSQESAELAPGDVAVPLDTAKIPEEDIVDQEDPYLHDRCRGGGPCTQQCRDTGSTVVCSCFVGYQLLPDGVSCEDTNECITGTHNCRIGEICINTVGTFRCQRESSCGTGYELMEDNTCKDIDECETGIHNCLPTFICQNTPGSFRCRPKLQCRGGFIQDALGNCIDINECLSINAPCPIGQTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDECSPPSEPCGAGHLCINTPGSFRCDCKAGYYFDGISRTCADINECRRYPGRLCGHKCENTPGSYHCSCTIGFKLSSDGRSCEDLNECSSSPCSQECANVYGSYQCYCRRGYQLSDVDGITCEDIDECALPTGGHICSYRCLNVPGSFQCHCPATGYRLAANGRSCQDIDECAAGTHNCSINATCFNIQGSFRCLSFDCPENYRRSGDTIRHEKTDTVRCIKSCRPIDVNCVLDPVHTISHTVISLPTFREFTRPEEIIFLRAVTPAYPANHADIIFDITEGNLRDSFDIIKRYLDGMTVGVVRQIRPIVGPFYVTLKLEMNYVVGGVVSHRNVVNVHIFVSEYWF |
Keywords
- PTM
Interaction
Subunit
Homomultimerizes and interacts with various extracellular matrix components.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 32-65 | Anaphylatoxin-like | ||||
Sequence: CCADGHRLATQKRDCSVPYASESKECRMVQEQCC | ||||||
Domain | 73-105 | Anaphylatoxin-like | ||||
Sequence: HCATGINVAHEGDSCDTHHNNSSFEAKFVKKCC | ||||||
Domain | 107-139 | Anaphylatoxin-like | ||||
Sequence: CCLLGKAAQAQGQSCEYNLMIGYQCGLVYRACC | ||||||
Domain | 355-397 | EGF-like | ||||
Sequence: DVDECSPPSEPCGAGHLCINTPGSFRCDCKAGYYFDGISRTCA | ||||||
Domain | 440-479 | EGF-like | ||||
Sequence: DLNECSSSPCSQECANVYGSYQCYCRRGYQLSDVDGITCE |
Sequence similarities
Belongs to the fibulin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length702
- Mass (Da)77,283
- Last updated2019-09-18 v1
- ChecksumA0C0CAECFEC8C7C8
Keywords
- Technical term