A0A4W3H9W6 · A0A4W3H9W6_CALMI
- ProteinCadherin 2
- Genecdh2
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids908 (go to sequence)
- Protein existencePredicted
- Annotation score4/5
Function
function
Cadherins are calcium-dependent cell adhesion proteins.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Chondrichthyes > Holocephali > Chimaeriformes > Callorhinchidae > Callorhinchus
Accessions
- Primary accessionA0A4W3H9W6
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Single-pass type I membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 704-735 | Helical | ||||
Sequence: IVAAGLGTGAIIAILLCFIILLILVLLFVIWM |
Keywords
- Cellular component
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 175-257 | Cadherin | ||||
Sequence: SDRDKNRSLRYSVTGPGADQPPTGIFNISPVSGQLAVLKPLDREEIASYHLRAHAVDLNGNQVENPIDIVINVIDMNDNRPEF | ||||||
Domain | 258-372 | Cadherin | ||||
Sequence: LHPIWNGSVPEGSKPGTYVMTVTSVDADDPHSSNGILRYKILSQTPSSPSSNMFTINNETGAIVTVAAGLDREKVPRYTLIIQATDMEGSPTYGLSNTATAVITVIDVNDNPPEF | ||||||
Domain | 373-487 | Cadherin | ||||
Sequence: TSVTFYGEVPENRINIVLANLTVTDKDHPHSRAWNAVYKITGGDPTGRFGVPTDPVSNDGLVTVVKPIDYEMNRAFVLTVIAENQVPLTTGIQLPPQSTATVSITVIDVNESPYF | ||||||
Domain | 488-595 | Cadherin | ||||
Sequence: IPNPKLIRQEEGLPADKQLTVFTAQDPDRYMHQTLRYSKLSDPANWLSIDSIHGHITTIATLDRESPYVNNNMYNATFLASDNGIPPASGTGTLQIYLLDINDNAPVV | ||||||
Domain | 594-704 | Cadherin | ||||
Sequence: VVSPQEASICERPYPSVINITAVDEDIDPNAGPFAFELPNRPVHVKKNWTITRLSGDYAQLNLKIGIDNGIYEIPIIITDSGNPPMSNTSVLLVKVCPCDENGDCTSIEAI | ||||||
Region | 759-781 | Disordered | ||||
Sequence: ILKYDEEGGGEEDQDYDLSQLQQ |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length908
- Mass (Da)99,511
- Last updated2019-09-18 v1
- Checksum7ADCEB780737A42B
Computationally mapped potential isoform sequences
There are 9 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A4W3GSX3 | A0A4W3GSX3_CALMI | cdh2 | 941 | ||
A0A4W3GSW2 | A0A4W3GSW2_CALMI | cdh2 | 921 | ||
A0A4W3GRF5 | A0A4W3GRF5_CALMI | cdh2 | 896 | ||
A0A4W3GRG0 | A0A4W3GRG0_CALMI | cdh2 | 893 | ||
A0A4W3GRC1 | A0A4W3GRC1_CALMI | cdh2 | 926 | ||
A0A4W3GRC7 | A0A4W3GRC7_CALMI | cdh2 | 923 | ||
A0A4W3H9Y8 | A0A4W3H9Y8_CALMI | cdh2 | 910 | ||
A0A4W3GUG0 | A0A4W3GUG0_CALMI | cdh2 | 894 | ||
A0A4W3GUC9 | A0A4W3GUC9_CALMI | cdh2 | 913 |
Keywords
- Technical term