Essential maintenance is planned to begin on Tue Jan 28 2025. The website may be temporarily unavailable. Please use our fallback: https://wwwdev.ebi.ac.uk/uniprot/front-end/fallback/ during this time.

A0A4C2EAI2 · A0A4C2EAI2_9SACH

  • Protein
    Mitochondrial distribution and morphology protein 10
  • Gene
    MDM10
  • Status
    UniProtKB unreviewed (TrEMBL)
  • Amino acids
  • Protein existence
    Inferred from homology
  • Annotation score
    2/5

Function

function

Component of the ERMES/MDM complex, which serves as a molecular tether to connect the endoplasmic reticulum and mitochondria. Components of this complex are involved in the control of mitochondrial shape and protein biogenesis and may function in phospholipid exchange. MDM10 is involved in the late assembly steps of the general translocase of the mitochondrial outer membrane (TOM complex). Functions in the TOM40-specific route of the assembly of outer membrane beta-barrel proteins, including the association of TOM40 with the receptor TOM22 and small TOM proteins. Can associate with the SAM(core) complex as well as the MDM12-MMM1 complex, both involved in late steps of the major beta-barrel assembly pathway, that is responsible for biogenesis of all outer membrane beta-barrel proteins. May act as a switch that shuttles between both complexes and channels precursor proteins into the TOM40-specific pathway. Plays a role in mitochondrial morphology and in the inheritance of mitochondria.

Caution

The sequence shown here is derived from an EMBL/GenBank/DDBJ whole genome shotgun (WGS) entry which is preliminary data.

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular ComponentERMES complex
Cellular ComponentSAM complex
Biological Processestablishment of mitochondrion localization
Biological Processmitochondrial genome maintenance
Biological Processmitochondrial outer membrane translocase complex assembly
Biological Processmitochondrion-endoplasmic reticulum membrane tethering
Biological Processphospholipid transport
Biological Processprotein insertion into mitochondrial outer membrane

Names & Taxonomy

Protein names

  • Recommended name
    Mitochondrial distribution and morphology protein 10
  • Alternative names
    • Mitochondrial inheritance component MDM10

Gene names

    • Name
      MDM10
    • ORF names
      ZYGM_002019

Organism names

  • Taxonomic identifier
  • Organism
  • Strain
    • Ca-7
  • Taxonomic lineage
    Eukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Zygosaccharomyces

Accessions

  • Primary accession
    A0A4C2EAI2

Proteomes

Subcellular Location

Mitochondrion outer membrane
; Multi-pass membrane protein
Note: The ERMES/MDM complex localizes to a few discrete foci (around 10 per single cell), that represent mitochondria-endoplasmic reticulum junctions. These foci are often found next to mtDNA nucleoids.

Keywords

Interaction

Subunit

Component of the ER-mitochondria encounter structure (ERMES) or MDM complex, composed of MMM1, MDM10, MDM12 and MDM34. Associates with the mitochondrial outer membrane sorting assembly machinery SAM(core) complex.

Family & Domains

Domain

Lacks alpha-helical transmembrane segments, suggesting that it resides in the membrane via beta-sheet conformations similar to those predicted for other outer membrane proteins and porin.

Sequence similarities

Belongs to the MDM10 family.

Keywords

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Length
    447
  • Mass (Da)
    51,586
  • Last updated
    2019-07-31 v1
  • MD5 Checksum
    18279399D3882915B70A1C2E8C9935AA
MLDYMDYVQRQFEKSTDWNYDNSYANILASSRNILDFSVPNQFKFQLSNRSTPHTFNTMEVFSRRMFNGAMTYLYTDAENMDKLVNNSSSISLQDVMETYRYVQPYYTHKPSFTGDNHVRSLYYGKMSYPTPNLEAMLIKRLNESTQLTLQCVSSFNGFNILTGYWQCDTGKNRHEVIMSSNDLLCGYRYLHNFLGTPSKLKTSLYNNFSLSIGYELWLGIVTLSPGCSTTLRYCTHSPNTGRPQTLTLTWNPLFGHISSTYTAKTNSSSTFSTKYDFNVYSIESNLSFGCEFWRRGPQEKSSLSQGTNEQKPEPEDDIMYYHMITPNGGNSIIPRANSPQEQQLLEDLTIAFSSSLKRIDKEKSMIEKFENRINQSNFTSVWKLSSSLKDANLRLLWEGKFKGFLLSAGTEFCKTNPQNEINENHPTENKLTFYPKKFGIQLQYST

Sequence databases

Nucleotide SequenceProtein SequenceMolecule TypeStatus
BIMX01000028
EMBL· GenBank· DDBJ
GCF01218.1
EMBL· GenBank· DDBJ
Genomic DNA

Genome annotation databases

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
Help