A0A494C114 · A0A494C114_HUMAN
- ProteinNeuregulin 1
- GeneNRG1
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids207 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Cellular Component | nucleoplasm | |
Cellular Component | plasma membrane | |
Molecular Function | signaling receptor binding | |
Biological Process | nervous system development |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionA0A494C114
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Single-pass type I membrane protein
Membrane ; Single-pass type I membrane protein
Keywords
- Cellular component
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 207 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Genetic variation databases
PTM/Processing
Features
Showing features for modified residue (large scale data), disulfide bond.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Modified residue (large scale data) | 32 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Disulfide bond | 178↔187 | UniProt | |||||
Sequence: CPNEFTGDRC |
Keywords
- PTM
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-51 | Disordered | ||||
Sequence: MSERKEGRGKGKGKKKERGSGKKPESAAGSQSPALPPRLKEMKSQESAAGS | ||||||
Domain | 37-128 | Ig-like | ||||
Sequence: PRLKEMKSQESAAGSKLVLRCETSSEYSSLRFKWFKNGNELNRKNKPQNIKIQKKPGKSELRINKASLADSGEYMCKVISKLGNDSASANIT | ||||||
Domain | 144-188 | EGF-like | ||||
Sequence: HLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQ |
Sequence similarities
Belongs to the neuregulin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length207
- Mass (Da)22,715
- Last updated2019-06-05 v1
- Checksum9E78DF98A10A2B5D
Computationally mapped potential isoform sequences
There are 19 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q02297 | NRG1_HUMAN | NRG1 | 640 | ||
H0YDC2 | H0YDC2_HUMAN | NRG1 | 236 | ||
H0YCP0 | H0YCP0_HUMAN | NRG1 | 126 | ||
H0YBA3 | H0YBA3_HUMAN | NRG1 | 713 | ||
A0A494BZT4 | A0A494BZT4_HUMAN | NRG1 | 214 | ||
A0A5F9ZHA5 | A0A5F9ZHA5_HUMAN | NRG1 | 168 | ||
A0A494C1G2 | A0A494C1G2_HUMAN | NRG1 | 387 | ||
A0A494C1F5 | A0A494C1F5_HUMAN | NRG1 | 624 | ||
A0A494C1F8 | A0A494C1F8_HUMAN | NRG1 | 607 | ||
A0A494C1B5 | A0A494C1B5_HUMAN | NRG1 | 483 | ||
A0A494C0L9 | A0A494C0L9_HUMAN | NRG1 | 522 | ||
A0A494C0K4 | A0A494C0K4_HUMAN | NRG1 | 459 | ||
A0A494C0Q4 | A0A494C0Q4_HUMAN | NRG1 | 700 | ||
A0A494C0T5 | A0A494C0T5_HUMAN | NRG1 | 130 | ||
A0A494C054 | A0A494C054_HUMAN | NRG1 | 155 | ||
A0A494C043 | A0A494C043_HUMAN | NRG1 | 461 | ||
E5RIG8 | E5RIG8_HUMAN | NRG1 | 135 | ||
E5RHQ1 | E5RHQ1_HUMAN | NRG1 | 101 | ||
E5RHP6 | E5RHP6_HUMAN | NRG1 | 308 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC021909 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC022833 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC022850 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC023948 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC068931 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC104000 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC104029 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
KF458727 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
KF458729 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |