A0A494C0D2 · A0A494C0D2_HUMAN
- ProteinTafazzin family protein
- GeneTAZ
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids163 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Acyltransferase which is required to remodel newly synthesized phospholipid cardiolipin, a key component of the mitochondrial inner membrane. Required for the initiation of mitophagy. Required to ensure progression of spermatocytes through meiosis.
Catalytic activity
- 1'-[1,2-diacyl-sn-glycero-3-phospho],3'-[1-acyl-sn-glycero-3-phospho]-glycerol + a 1,2-diacyl-sn-glycero-3-phosphocholine = a 1-acyl-sn-glycero-3-phosphocholine + a cardiolipinThis reaction proceeds in the forward and the backward directions.
- 1,2-di-(9Z-octadecenoyl)-sn-glycero-3-phosphocholine + 1-hexadecanoyl-sn-glycero-3-phosphocholine = 1-(9Z-octadecenoyl)-sn-glycero-3-phosphocholine + 1-hexadecanoyl-2-(9Z-octadecenoyl)-sn-glycero-3-phosphocholineThis reaction proceeds in the forward and the backward directions.
- 1,2-diacyl-sn-glycero-3-phospho-(1'-sn-glycerol) + a 1-acyl-sn-glycero-3-phosphate = 1-acyl-sn-glycero-3-phospho-(1'-sn-glycerol) + a 1,2-diacyl-sn-glycero-3-phosphateThis reaction proceeds in the forward and the backward directions.
- 1-(9Z-octadecenoyl)-sn-glycero-3-phosphate + 1-hexadecanoyl-2-(9Z,12Z-octadecadienoyl)-sn-glycero-3-phospho-(1'-sn-glycerol) = 1-(9Z)-octadecenoyl-2-(9Z,12Z)-octadecadienoyl-sn-glycero-3-phosphate + 1-hexadecanoyl-sn-glycero-3-phospho-(1'-sn-glycerol)This reaction proceeds in the forward and the backward directions.
- 1-hexadecanoyl-2-(9Z,12Z-octadecadienoyl)-sn-glycero-3-phosphocholine + 1-hexadecanoyl-sn-glycero-3-phosphocholine = 1,2-dihexadecanoyl-sn-glycero-3-phosphocholine + 2-(9Z,12Z-octadecadienoyl)-sn-glycero-3-phosphocholineThis reaction proceeds in the forward and the backward directions.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial inner membrane | |
Cellular Component | mitochondrial outer membrane | |
Molecular Function | acyltransferase activity | |
Biological Process | phospholipid metabolic process |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameTafazzin family protein
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionA0A494C0D2
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Mitochondrion inner membrane ; Peripheral membrane protein
Mitochondrion outer membrane ; Peripheral membrane protein
Keywords
- Cellular component
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 97 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
PTM/Processing
Proteomic databases
Expression
Gene expression databases
Interaction
Subunit
Associates with multiple protein complexes.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 23-85 | Phospholipid/glycerol acyltransferase | ||||
Sequence: EGGDGVYQKGMDFILEKLNHGDWVHIFPEGKVNMSSEFLRFKWGIGRLIAECHLNPIILPLWH |
Sequence similarities
Belongs to the taffazin family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusFragment
- Length163
- Mass (Da)18,659
- Last updated2019-06-05 v1
- Checksum5FAFF369723DF4F8
Computationally mapped potential isoform sequences
There are 13 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q16635 | TAZ_HUMAN | TAFAZZIN | 262 | ||
C9J699 | C9J699_HUMAN | TAZ | 184 | ||
A0A499FJ53 | A0A499FJ53_HUMAN | TAZ | 280 | ||
F6Y2X3 | F6Y2X3_HUMAN | TAFAZZIN | 262 | ||
H7C2I9 | H7C2I9_HUMAN | TAFAZZIN | 34 | ||
A6XNE1 | A6XNE1_HUMAN | TAFAZZIN | 296 | ||
A0A494C004 | A0A494C004_HUMAN | TAZ | 311 | ||
A0A494C0V5 | A0A494C0V5_HUMAN | TAZ | 186 | ||
A0A494C1C6 | A0A494C1C6_HUMAN | TAFAZZIN | 31 | ||
A0A494C1B0 | A0A494C1B0_HUMAN | TAFAZZIN | 31 | ||
A0A494C141 | A0A494C141_HUMAN | TAZ | 265 | ||
A0A494C0C5 | A0A494C0C5_HUMAN | TAZ | 223 | ||
A0A087WWD5 | A0A087WWD5_HUMAN | TAFAZZIN | 95 |
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: V |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC244090 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC245140 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |