A0A493TE53 · A0A493TE53_ANAPP
- ProteinAurora kinase
- GeneAURKA
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids405 (go to sequence)
- Protein existenceInferred from homology
- Annotation score5/5
Function
Catalytic activity
- ATP + L-seryl-[protein] = ADP + H+ + O-phospho-L-seryl-[protein]
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 142 | ATP (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 161 | ATP (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 210-212 | ATP (UniProtKB | ChEBI) | ||||
Sequence: EYA | ||||||
Active site | 255 | Proton acceptor | ||||
Sequence: D | ||||||
Binding site | 259-260 | ATP (UniProtKB | ChEBI) | ||||
Sequence: EN | ||||||
Binding site | 273 | ATP (UniProtKB | ChEBI) | ||||
Sequence: D |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameAurora kinase
- EC number
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Archelosauria > Archosauria > Dinosauria > Saurischia > Theropoda > Coelurosauria > Aves > Neognathae > Galloanserae > Anseriformes > Anatidae > Anatinae > Anas
Accessions
- Primary accessionA0A493TE53
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
PTM/Processing
Features
Showing features for cross-link.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Cross-link | 257 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K |
Keywords
- PTM
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 20-130 | Disordered | ||||
Sequence: DGPKRVPVSQHSAQSRVLNSGGQAQRVLCPSNLAQRVPVQSQKSVPSNQKLSNNQTTQQPRPKFLVQPMARPQVPSKTNEKPQQAPAPGNSEDDAESSSKQKNEERQWSLD | ||||||
Compositional bias | 27-82 | Polar residues | ||||
Sequence: VSQHSAQSRVLNSGGQAQRVLCPSNLAQRVPVQSQKSVPSNQKLSNNQTTQQPRPK | ||||||
Compositional bias | 91-113 | Polar residues | ||||
Sequence: PQVPSKTNEKPQQAPAPGNSEDD | ||||||
Compositional bias | 114-130 | Basic and acidic residues | ||||
Sequence: AESSSKQKNEERQWSLD | ||||||
Domain | 132-382 | Protein kinase | ||||
Sequence: FEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKTQLEEAGVEHQLRREVEIQSHLRHPNILRLYGYFHDVTRVYLILEYAPRGEVYKELQKLTKFDEQRTATYITELADALSYCHSKNVIHRDIKPENLLLGSNGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGRTHDEKVDIWSLGVLCYEFLVGKPPFEAATYQETYRAISRVEFKYPAFVTEGAKDLISKLLKHNPFHRMPLKDVLVHPWI |
Sequence similarities
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length405
- Mass (Da)45,860
- Last updated2019-06-05 v1
- Checksum63379F2982C3088B
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
U3IAE4 | U3IAE4_ANAPP | AURKA | 347 | ||
A0A493T9N6 | A0A493T9N6_ANAPP | AURKA | 258 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 27-82 | Polar residues | ||||
Sequence: VSQHSAQSRVLNSGGQAQRVLCPSNLAQRVPVQSQKSVPSNQKLSNNQTTQQPRPK | ||||||
Compositional bias | 91-113 | Polar residues | ||||
Sequence: PQVPSKTNEKPQQAPAPGNSEDD | ||||||
Compositional bias | 114-130 | Basic and acidic residues | ||||
Sequence: AESSSKQKNEERQWSLD |
Keywords
- Technical term