A0A482MGY4 · A0A482MGY4_9CAUD
- ProteinTerminase, large subunit
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids587 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
The terminase large subunit acts as an ATP driven molecular motor necessary for viral DNA translocation into empty capsids and as an endonuclease that cuts the viral genome at a unique and precise dsDNA sequence to initiate and to end a packaging reaction. The terminase lies at a unique vertex of the procapsid and is composed of two subunits, a small terminase subunit involved in viral DNA recognition (packaging sequence), and a large terminase subunit possessing endonucleolytic and ATPase activities. Both terminase subunits heterooligomerize and are docked on the portal protein to form the packaging machine. The terminase large subunit exhibits endonuclease activity and cleaves the viral genome concatemer. Once the DNA is packaged, the terminase detaches from the portal and gets replaced by the tail to finish maturation of the virion.
Cofactor
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 365 | Mg2+ 1 (UniProtKB | ChEBI); catalytic; for nuclease activity | ||||
Sequence: D | ||||||
Binding site | 365 | Mg2+ 2 (UniProtKB | ChEBI); catalytic; for nuclease activity | ||||
Sequence: D | ||||||
Binding site | 421 | Mg2+ 2 (UniProtKB | ChEBI); catalytic; for nuclease activity | ||||
Sequence: E | ||||||
Binding site | 519 | Mg2+ 1 (UniProtKB | ChEBI); catalytic; for nuclease activity | ||||
Sequence: D |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | viral terminase, large subunit | |
Molecular Function | ATP binding | |
Molecular Function | ATP hydrolysis activity | |
Molecular Function | endonuclease activity | |
Molecular Function | metal ion binding | |
Biological Process | chromosome organization | |
Biological Process | viral DNA genome packaging |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameTerminase, large subunit
- Alternative names
Including 2 domains:
- Recommended nameATPase
- EC number
- Recommended nameEndonuclease
- EC number
Gene names
Organism names
- Organism
- Taxonomic lineageViruses > Duplodnaviria > Heunggongvirae > Uroviricota > Caudoviricetes > Autographiviridae > Studiervirinae > Teetrevirus
Accessions
- Primary accessionA0A482MGY4
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Interaction
Subunit
Homopentamer. Interacts with the terminase small subunit; the active complex is probably heterooligomeric. Interacts with the portal protein.
Structure
Family & Domains
Features
Showing features for motif, region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 59-66 | Walker A motif | ||||
Sequence: AFRGIGKS | ||||||
Motif | 157-162 | Walker B motif | ||||
Sequence: IIIADD | ||||||
Region | 345-430 | Nuclease activity | ||||
Sequence: HSYHSCSQNTGQYQQRILVIDPSGRGKDETGYAVLFTLNGYIYLMEAGGFRDGYSDKTLESLAKKAKQWKVQTVVFESNFGDGMFG | ||||||
Domain | 364-471 | Terminase large subunit ribonuclease H-like | ||||
Sequence: IDPSGRGKDETGYAVLFTLNGYIYLMEAGGFRDGYSDKTLESLAKKAKQWKVQTVVFESNFGDGMFGKVFSPVLLKHHAAQLEEIRARGMKELRICDTLEPVLSTHRL | ||||||
Region | 572-587 | Involved in prohead binding | ||||
Sequence: LYWEDDDMNGDRFINW |
Domain
The ATPase region is in the N-terminus, whereas the nuclease region is in the central part. The C-terminus is involved in prohead binding.
Sequence similarities
Belongs to the Teseptimavirus large terminase family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length587
- Mass (Da)66,713
- Last updated2019-06-05 v1
- Checksum332B085353FCFC5E