A0A455AH88 · A0A455AH88_PHYMC

Function

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular Componentbasolateral plasma membrane
Cellular Componentextracellular exosome
Cellular Componentimmunological synapse
Cellular Componentlateral plasma membrane
Cellular Componenttetraspanin-enriched microdomain
Molecular Functioncholesterol binding
Molecular Functionintegrin binding
Molecular FunctionMHC class II protein binding
Molecular Functiontransferrin receptor binding
Molecular Functionvirus receptor activity
Biological ProcessCD4-positive, alpha-beta T cell costimulation
Biological Processcellular response to low-density lipoprotein particle stimulus
Biological Processhumoral immune response mediated by circulating immunoglobulin
Biological Processimmunological synapse formation
Biological Processmacrophage fusion
Biological Processmyoblast fusion involved in skeletal muscle regeneration
Biological Processosteoclast fusion
Biological Processpositive regulation of adaptive immune memory response
Biological Processpositive regulation of B cell proliferation
Biological Processpositive regulation of B cell receptor signaling pathway
Biological Processpositive regulation of CD4-positive, alpha-beta T cell proliferation
Biological Processpositive regulation of inflammatory response to antigenic stimulus
Biological Processpositive regulation of MAPK cascade
Biological Processpositive regulation of protein catabolic process in the vacuole
Biological Processpositive regulation of protein exit from endoplasmic reticulum
Biological Processpositive regulation of receptor clustering
Biological Processpositive regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell
Biological Processpositive regulation of T cell receptor signaling pathway
Biological Processpositive regulation of T-helper 2 cell cytokine production
Biological Processpositive regulation of transcription by RNA polymerase II
Biological Processprotein localization to lysosome
Biological Processprotein localization to plasma membrane
Biological Processreceptor internalization
Biological Processregulation of macrophage migration
Biological Processregulation of protein stability

Keywords

Names & Taxonomy

Protein names

  • Recommended name
    Tetraspanin

Gene names

    • Name
      CD81

Organism names

Accessions

  • Primary accession
    A0A455AH88

Proteomes

Subcellular Location

Basolateral cell membrane
; Multi-pass membrane protein
Cell membrane
; Multi-pass membrane protein
Lateral cell membrane
; Multi-pass membrane protein
Membrane
; Multi-pass membrane protein

Features

Showing features for transmembrane.

TypeIDPosition(s)Description
Transmembrane12-37Helical
Transmembrane57-78Helical
Transmembrane90-114Helical
Transmembrane202-230Helical

Keywords

  • Cellular component

Interaction

Protein-protein interaction databases

Family & Domains

Sequence similarities

Belongs to the tetraspanin (TM4SF) family.

Keywords

Phylogenomic databases

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Length
    236
  • Mass (Da)
    25,740
  • Last updated
    2019-06-05 v1
  • Checksum
    6A2ADDE5BC0D7062
MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDRPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAIMDDDASNAKAVVKTFHETLNCCGSNALTTVTTSVFKNSLCPSGGNVISNLLKEDCHGKIDELFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY

Computationally mapped potential isoform sequences

There is 1 potential isoform mapped to this entry

View all
EntryEntry nameGene nameLength
A0A455AFH3A0A455AFH3_PHYMCCD81165

Keywords

Sequence databases

Genome annotation databases

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp