A0A453SFJ2 · A0A453SFJ2_AEGTS
- ProteinProtein kinase domain-containing protein
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids468 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Molecular Function | ATP binding | |
Molecular Function | calcium-dependent protein serine/threonine kinase activity | |
Molecular Function | calcium/calmodulin-dependent protein kinase activity | |
Molecular Function | calmodulin binding | |
Biological Process | intracellular signal transduction | |
Biological Process | peptidyl-serine phosphorylation | |
Biological Process | protein autophosphorylation |
Keywords
- Molecular function
- Ligand
Names & Taxonomy
Protein names
- Recommended nameProtein kinase domain-containing protein
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Pooideae > Triticodae > Triticeae > Triticinae > Aegilops
Accessions
- Primary accessionA0A453SFJ2
Proteomes
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-113 | Disordered | ||||
Sequence: MGQCYGKGASARGGAGDDDFGVVAETHSPPPANGAPQTPPPRQPTPAAAAGTPRRRKSGSTTPVHQTPGVAWPSPYPAGGTSPLPAGVSPSPARSTPRRFFKRPFPPPSPAKH | ||||||
Compositional bias | 32-47 | Pro residues | ||||
Sequence: ANGAPQTPPPRQPTPA | ||||||
Domain | 171-433 | Protein kinase | ||||
Sequence: YELGKEVGRGHFGHTCSAVVKKGEYKGQTVAVKIISKAKMTTAISIEDVRREVKILKALSGHNNLVKFYDACEDALNVYIVMELCEGGELLDRILARGGRYTEEDAKAIVVQILSVVAFCHLQGVVHRDLKPENFLFTTRDENAPMKLIDFGLSDFIRPDERLNDIVGSAYYVAPEVLHRSYSMEADIWSIGVITYILLCGSRPFWARTESGIFRSVLRADPNLDDSPWPSVSAEAKDFVKRFLNKDYRKRMTAVQALTHPWL |
Sequence similarities
Belongs to the protein kinase superfamily.
Family and domain databases
Sequence
- Sequence statusComplete
- Length468
- Mass (Da)50,947
- Last updated2019-05-08 v1
- Checksum1D58C40E2A307ADE
Computationally mapped potential isoform sequences
There are 7 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A453SH87 | A0A453SH87_AEGTS | 635 | |||
A0A453SHA1 | A0A453SHA1_AEGTS | 490 | |||
A0A453SGU0 | A0A453SGU0_AEGTS | 213 | |||
A0A453SGU4 | A0A453SGU4_AEGTS | 184 | |||
A0A453SH91 | A0A453SH91_AEGTS | 412 | |||
A0A453SH94 | A0A453SH94_AEGTS | 444 | |||
A0A453SFJ6 | A0A453SFJ6_AEGTS | 362 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 32-47 | Pro residues | ||||
Sequence: ANGAPQTPPPRQPTPA |
Keywords
- Technical term