A0A452DI16 · A0A452DI16_BOVIN
- ProteinMetalloproteinase inhibitor 1
- GeneTIMP1
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids244 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling.
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | mitochondrion | |
Molecular Function | growth factor activity | |
Molecular Function | MAP kinase kinase kinase activity | |
Molecular Function | metal ion binding | |
Molecular Function | metalloendopeptidase inhibitor activity | |
Biological Process | MAPK cascade |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameMetalloproteinase inhibitor 1
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Laurasiatheria > Artiodactyla > Ruminantia > Pecora > Bovidae > Bovinae > Bos
Accessions
- Primary accessionA0A452DI16
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Features
Showing features for disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Disulfide bond | 61↔130 | |||||
Sequence: CTCVPPHPQTAFCNSDVVIRAKFVGTAEVNETALYQRYEIKMTKMFKGFSALRDAPDIRFIYTPAMESVC | ||||||
Disulfide bond | 63↔159 | |||||
Sequence: CVPPHPQTAFCNSDVVIRAKFVGTAEVNETALYQRYEIKMTKMFKGFSALRDAPDIRFIYTPAMESVCGYFHRSQNRSEEFLIAGQLSNGHLHITTC | ||||||
Disulfide bond | 73↔184 | |||||
Sequence: CNSDVVIRAKFVGTAEVNETALYQRYEIKMTKMFKGFSALRDAPDIRFIYTPAMESVCGYFHRSQNRSEEFLIAGQLSNGHLHITTCSFVAPWNSMSSAQRRGFTKTYAAGC | ||||||
Disulfide bond | 187↔234 | |||||
Sequence: CTVFPCSSIPCKLQSDTHCLWTDQLLTGSDKGFQSRHLACLPREPGLC | ||||||
Disulfide bond | 192↔197 | |||||
Sequence: CSSIPC | ||||||
Disulfide bond | 205↔226 | |||||
Sequence: CLWTDQLLTGSDKGFQSRHLAC |
Keywords
- PTM
Expression
Gene expression databases
Interaction
Subunit
Interacts with MMP1, MMP3, MMP10 and MMP13, but has only very low affinity for MMP14. Interacts with CD63; identified in a complex with CD63 and ITGB1.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 61-184 | NTR | ||||
Sequence: CTCVPPHPQTAFCNSDVVIRAKFVGTAEVNETALYQRYEIKMTKMFKGFSALRDAPDIRFIYTPAMESVCGYFHRSQNRSEEFLIAGQLSNGHLHITTCSFVAPWNSMSSAQRRGFTKTYAAGC |
Sequence similarities
Belongs to the protease inhibitor I35 (TIMP) family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length244
- Mass (Da)27,455
- Last updated2024-05-29 v2
- Checksum71C44F7F1A5AE473
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0AAA9SIJ7 | A0AAA9SIJ7_BOVIN | TIMP1 | 265 | ||
A0AAA9SPH5 | A0AAA9SPH5_BOVIN | TIMP1 | 137 |
Keywords
- Technical term