A0A419FDC6 · A0A419FDC6_UNCZI
- ProteinDihydroorotase
- GeneselB
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids1061 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
Catalyzes the reversible cyclization of carbamoyl aspartate to dihydroorotate.
Translation factor necessary for the incorporation of selenocysteine into proteins. It probably replaces EF-Tu for the insertion of selenocysteine directed by the UGA codon. SelB binds GTP and GDP.
Catalytic activity
- (S)-dihydroorotate + H2O = H+ + N-carbamoyl-L-aspartate
Cofactor
Note: Binds 2 Zn2+ ions per subunit.
Pathway
Pyrimidine metabolism; UMP biosynthesis via de novo pathway; (S)-dihydroorotate from bicarbonate: step 3/3.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 65 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 67 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 67-69 | substrate | ||||
Sequence: HLR | ||||||
Binding site | 99 | substrate | ||||
Sequence: N | ||||||
Binding site | 156 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 156 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 183 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 236 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Active site | 309 | |||||
Sequence: D | ||||||
Binding site | 309 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 313 | substrate | ||||
Sequence: H | ||||||
Binding site | 327-328 | substrate | ||||
Sequence: FG |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | allantoinase activity | |
Molecular Function | dihydroorotase activity | |
Molecular Function | GTP binding | |
Molecular Function | GTPase activity | |
Molecular Function | RNA binding | |
Molecular Function | translation elongation factor activity | |
Molecular Function | zinc ion binding | |
Biological Process | 'de novo' UMP biosynthetic process | |
Biological Process | purine nucleobase catabolic process | |
Biological Process | selenocysteine incorporation |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDihydroorotase
- EC number
- Short namesDHOase
Gene names
Organism names
- Strain
- Taxonomic lineageBacteria
Accessions
- Primary accessionA0A419FDC6
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 419-588 | Tr-type G | ||||
Sequence: PRHMIAATAGHIDHGKTALVRALTGMETDRLEEEKRRGITIELGFAFLGRNVTLIDVPGHERFIKTMVAGVSTVDLGLLVVAADDGVMPQTREHLDILRLLGVPRLFAVLTKVDGLEPDWVGMIEEEVRELLPDEYRAATPFFRCDALSGEGVEALKTALLALADRLPPR |
Sequence similarities
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,061
- Mass (Da)115,062
- Last updated2019-05-08 v1
- ChecksumCF4C1EECD2C03165