A0A3S2PNP1 · A0A3S2PNP1_ORYJA
- ProteinCoatomer subunit gamma
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids848 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | COPI vesicle coat | |
Cellular Component | endoplasmic reticulum | |
Cellular Component | endoplasmic reticulum-Golgi intermediate compartment | |
Cellular Component | Golgi membrane | |
Molecular Function | structural molecule activity | |
Biological Process | endoplasmic reticulum to Golgi vesicle-mediated transport | |
Biological Process | intra-Golgi vesicle-mediated transport | |
Biological Process | intracellular protein transport | |
Biological Process | organelle transport along microtubule | |
Biological Process | protein secretion |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameCoatomer subunit gamma
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Neoteleostei > Acanthomorphata > Ovalentaria > Atherinomorphae > Beloniformes > Adrianichthyidae > Oryziinae > Oryzias
Accessions
- Primary accessionA0A3S2PNP1
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Golgi apparatus membrane ; Peripheral membrane protein
Cytoplasmic vesicle, COPI-coated vesicle membrane ; Peripheral membrane protein
Keywords
- Cellular component
Interaction
Subunit
Oligomeric complex.
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-21 | Disordered | ||||
Sequence: MIKKFDKKDEESGSGSNPFQH | ||||||
Domain | 24-202 | Clathrin/coatomer adaptor adaptin-like N-terminal | ||||
Sequence: KSAVLQEARIFNETPINPRRCLHILTKIIYLLNQGEHFGTTEATEAFFAMTRLFQSNDQTLRRMCYLTIKEMANISEDVIIVTSSLTKDMTGKEDVYRGPAIRALCRITDTTMLQAIERYMKQAIVDKVPSVSSSALVSSLHMVKMSYDVVKRWVNEAQEAASSDNIMVQYHALGLFLR | ||||||
Domain | 204-513 | Clathrin/coatomer adaptor adaptin-like N-terminal | ||||
Sequence: LTVLIRIASKLLDETEGGHDSPLFDFIEGCLRNKNEMVVYEAASAIVHMPNCTARELAPAVSVLQLFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGSESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMNFLSNMLRDDGGFEYKRAIVDCIISIIEENPESKETGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPQPSKYIRFIFNRVVLESEAVRAAAVSALAKFGAQNDDLLPSVLVLMQRCMMDSDDEVRDRATFYMNVLQQK | ||||||
Domain | 587-733 | Coatomer gamma subunit appendage Ig-like subdomain | ||||
Sequence: IYQEQLASIPEFQSLGPLFKSSDPVQLTEAETEYVVRCIKHTFARHMVFQFDCTNTLNDQLLQKVVVQMEPSEAYEVEHYIPAPSLPYSQPGSCYTLIRLPDDDPSAVSCTFSCTMKYLVRDCDPNTGEPDDDGYDDEYVLEDLEVT | ||||||
Domain | 735-847 | Coatomer subunit gamma C-terminal | ||||
Sequence: ADHIQKVLKPNFGAAWEEVGDEFEKEETFALASVRTLDEAVNNIITFLGMQPCERSDKVPENKNSHVLFLAGVFRGGHDVLVRARLALADGVTMQVTVRSSEETVVDVILASV |
Sequence similarities
Belongs to the COPG family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length848
- Mass (Da)94,697
- Last updated2019-04-10 v1
- ChecksumFFAE24ED1BBE6C56
Keywords
- Technical term