A0A3S2N598 · A0A3S2N598_ORYJA
- ProteinVascular endothelial growth factor receptor 2
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids1328 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
Catalytic activity
- L-tyrosyl-[protein] + ATP = O-phospho-L-tyrosyl-[protein] + ADP + H+
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 832-839 | ATP (UniProtKB | ChEBI) | ||||
Sequence: GRGAFGQV | ||||||
Binding site | 859 | ATP (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Active site | 1015 | Proton acceptor | ||||
Sequence: D | ||||||
Binding site | 1019 | ATP (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 1020 | Mg2+ (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 1033 | Mg2+ (UniProtKB | ChEBI) | ||||
Sequence: D |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | early endosome | |
Cellular Component | endoplasmic reticulum | |
Cellular Component | membrane | |
Cellular Component | receptor complex | |
Molecular Function | ATP binding | |
Molecular Function | growth factor binding | |
Molecular Function | metal ion binding | |
Molecular Function | vascular endothelial growth factor receptor activity | |
Biological Process | angiogenesis | |
Biological Process | cell migration | |
Biological Process | endothelial cell differentiation | |
Biological Process | positive regulation of angiogenesis | |
Biological Process | positive regulation of cell migration | |
Biological Process | positive regulation of kinase activity | |
Biological Process | protein phosphorylation | |
Biological Process | regulation of MAPK cascade | |
Biological Process | vascular endothelial growth factor receptor signaling pathway |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameVascular endothelial growth factor receptor 2
- EC number
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Neoteleostei > Acanthomorphata > Ovalentaria > Atherinomorphae > Beloniformes > Adrianichthyidae > Oryziinae > Oryzias
Accessions
- Primary accessionA0A3S2N598
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Single-pass type I membrane protein
Membrane ; Single-pass type I membrane protein
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-22 | |||||
Sequence: MMARAVTVLSLLITLEIIYVSA | ||||||
Chain | PRO_5018657397 | 23-1328 | Vascular endothelial growth factor receptor 2 | |||
Sequence: IDPRFMSDPPTLNINGTHRMNKSDNLELICRGRQYVKWSTPPTSARFSISDCSGSGFFCSALSITNATVNETGEYQCSYPDLKAGDGRKAVYVFVHDHRVPFVPYEKEYEVVFIREGERVVIPCRGSLENLNVTLNIKYPIKELHPDGKDLVWDAKTGFTVPTHLISYAGVVSCQTQIGNETFKSPLYIVAVVGYKIHDLTLTPVQQRLVVGERLELICTANTELNVGIEFNWTHSGGALTSKPLHTVPHKKKLWNSLELSNTLIVENVTTEHTGEFSCTASSGKMFKTASAHVRVYEKPFIEIKEPWQKVWEVTVGAQASYLVRYSAYPEPSFKWLKDGQTLKENYRIKQKSDALVFRGGVVEADGGNYTMILSNKATKEEQRSSFQLLVNLPPRIIEKEVPVDMYSYGGSPDLTCTARGFPVPESIQWQWMPKEDCREAFVPGVIKPEVVDKCKNWRDISNSSGYNHIERTTTDIDPHAKKIVSTLRIRNADTHSLYRCTASNKVGKDHRIIIFRVTSNLEVSMSPSDKPLEEDNVALRCKADKLVYTNLTWFLATNVSKSEQDAPIQPCHSMSLLPLPLSQAALPSQQGTNITLELMLPNASFQDEGLYACQVVNIKTGVKTCLLRRLALRDLMPARIRNNFTDQKVNVSATITLHCDAFGTPNPTVVWTKNNNTVVEGSGVILNQNNLTIQRVKQQDSGLYTCTACNSRGCYTSQAVLTVEGAEEKTNVELIVPIGSVVIAMFFWLLIVFVIRGRKRPNVDLKTGYLSMILDSEDMPMDEQCERLTYDANKWEFPRDRLKLGEPLGRGAFGQVVEAAAFGIEKVTTCTTVAVKMLKEGATTSEYRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEYCKYGNLSSYLKSKRGEYSPYKRKRLDSVRWVSAEEDVTEGDLGLGKVAQLDICTGTAEDKLPGNSANTDEESAVDDHLTMEDLICYSFQVAKGMEFLSSRKCIHRDLAARNILLSENNVVKICDFGLARDVYKDPDYVRKGDARLPLKWMAPETIFDRVYTTQSDVWSFGVLLWEIFSLGASPYPGVCIDESFCRRLKEGTRMRPPEYATSEIYQTMLDCWLDRPTDRPTFAELVEHLGNLLQANAQQDGKDYIPLTSDEVKRCSAPTDPCSRPQSQEMLSCHYDHPSSLGLSQQSERCSQPVGVKTFEDIPLVRSSGMEGHSGCRTGFSPEEGKSLNHHPQATPNLSQLLRCKSKESLGSESSNQTSGYQSGYHSDDTDTPIYANEEMIMKHNKLKKPPPPGTPDKFSTEIRYSTPPV |
Keywords
- PTM
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 208-317 | Ig-like | ||||
Sequence: PLYIVAVVGYKIHDLTLTPVQQRLVVGERLELICTANTELNVGIEFNWTHSGGALTSKPLHTVPHKKKLWNSLELSNTLIVENVTTEHTGEFSCTASSGKMFKTASAHVR | ||||||
Domain | 322-410 | Ig-like | ||||
Sequence: PFIEIKEPWQKVWEVTVGAQASYLVRYSAYPEPSFKWLKDGQTLKENYRIKQKSDALVFRGGVVEADGGNYTMILSNKATKEEQRSSFQ | ||||||
Domain | 417-541 | Ig-like | ||||
Sequence: PRIIEKEVPVDMYSYGGSPDLTCTARGFPVPESIQWQWMPKEDCREAFVPGVIKPEVVDKCKNWRDISNSSGYNHIERTTTDIDPHAKKIVSTLRIRNADTHSLYRCTASNKVGKDHRIIIFRVT | ||||||
Domain | 556-640 | Ig-like | ||||
Sequence: EEDNVALRCKADKLVYTNLTWFLATNVSKSEQDAPIQPCHSMSLLPLPLSQAALPSQQGTNITLELMLPNASFQDEGLYACQVVN | ||||||
Domain | 660-745 | Ig-like | ||||
Sequence: PARIRNNFTDQKVNVSATITLHCDAFGTPNPTVVWTKNNNTVVEGSGVILNQNNLTIQRVKQQDSGLYTCTACNSRGCYTSQAVLT | ||||||
Domain | 825-1149 | Protein kinase | ||||
Sequence: LKLGEPLGRGAFGQVVEAAAFGIEKVTTCTTVAVKMLKEGATTSEYRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEYCKYGNLSSYLKSKRGEYSPYKRKRLDSVRWVSAEEDVTEGDLGLGKVAQLDICTGTAEDKLPGNSANTDEESAVDDHLTMEDLICYSFQVAKGMEFLSSRKCIHRDLAARNILLSENNVVKICDFGLARDVYKDPDYVRKGDARLPLKWMAPETIFDRVYTTQSDVWSFGVLLWEIFSLGASPYPGVCIDESFCRRLKEGTRMRPPEYATSEIYQTMLDCWLDRPTDRPTFAELVEHLGN | ||||||
Region | 1224-1328 | Disordered | ||||
Sequence: RSSGMEGHSGCRTGFSPEEGKSLNHHPQATPNLSQLLRCKSKESLGSESSNQTSGYQSGYHSDDTDTPIYANEEMIMKHNKLKKPPPPGTPDKFSTEIRYSTPPV | ||||||
Compositional bias | 1246-1288 | Polar residues | ||||
Sequence: LNHHPQATPNLSQLLRCKSKESLGSESSNQTSGYQSGYHSDDT |
Sequence similarities
Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,328
- Mass (Da)148,496
- Last updated2019-04-10 v1
- ChecksumB24E1542A6599E95
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1246-1288 | Polar residues | ||||
Sequence: LNHHPQATPNLSQLLRCKSKESLGSESSNQTSGYQSGYHSDDT |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CM012440 EMBL· GenBank· DDBJ | RVE73796.1 EMBL· GenBank· DDBJ | Genomic DNA |