A0A3Q1MEI8 · A0A3Q1MEI8_BOVIN
- ProteinNADPH--cytochrome P450 reductase
- GenePOR
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids633 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
This enzyme is required for electron transfer from NADP to cytochrome P450 in microsomes. It can also provide electron transfer to heme oxygenase and cytochrome B5.
Catalytic activity
- NADPH + 2 oxidized [cytochrome P450] = H+ + NADP+ + 2 reduced [cytochrome P450]
Cofactor
Protein has several cofactor binding sites:
Note: Binds 1 FAD per monomer.
Note: Binds 1 FMN per monomer.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 41-46 | FMN (UniProtKB | ChEBI) | ||||
Sequence: SQTGTA | ||||||
Binding site | 93-96 | FMN (UniProtKB | ChEBI) | ||||
Sequence: ATYG | ||||||
Binding site | 128-137 | FMN (UniProtKB | ChEBI) | ||||
Sequence: LGNKTYEHFN | ||||||
Binding site | 163 | FMN (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 253 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 379 | FAD (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 409-412 | FAD (UniProtKB | ChEBI) | ||||
Sequence: RYYS | ||||||
Binding site | 427-429 | FAD (UniProtKB | ChEBI) | ||||
Sequence: CAV | ||||||
Binding site | 433 | FAD (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 443-446 | FAD (UniProtKB | ChEBI) | ||||
Sequence: GVAT | ||||||
Binding site | 490 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 551-552 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: SR | ||||||
Binding site | 557-561 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: KVYVQ | ||||||
Binding site | 594 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 632 | FAD (UniProtKB | ChEBI) | ||||
Sequence: W |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum membrane | |
Molecular Function | flavin adenine dinucleotide binding | |
Molecular Function | FMN binding | |
Molecular Function | NADP binding | |
Molecular Function | NADPH-hemoprotein reductase activity |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameNADPH--cytochrome P450 reductase
- EC number
- Short namesCPR ; P450R
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Laurasiatheria > Artiodactyla > Ruminantia > Pecora > Bovidae > Bovinae > Bos
Accessions
- Primary accessionA0A3Q1MEI8
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Endoplasmic reticulum membrane ; Single-pass membrane protein
Keywords
- Cellular component
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 35-179 | Flavodoxin-like | ||||
Sequence: IIVFYGSQTGTAEEFANRLSKDAHRYGMRGMAADPEEYDLADLSSLPEIEKALAIFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKYAVFALGNKTYEHFNAMGKYVDKRLEQLGAQRIFDLGLGDDDGNLEEDFITWREQFW | ||||||
Domain | 234-476 | FAD-binding FR-type | ||||
Sequence: KNPFLAVVTTNRKLNQGTERHLMHLELDISDSKIRYESGDHVAVYPANDSALVNQLGEILGADLDIIMSLNNLDEESNKKHPFPCPTSYRTALTYYLDITNPPRTNVLYELAQYASEPTEHEQLRKMASSSGEGKELYLRWVLEARRHILAILQDYPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSVHICAVAVEYETKTGRINKGVATSWLRAKEPAGENGGRALVPMYVRKSQFRLP |
Sequence similarities
Belongs to the NADPH--cytochrome P450 reductase family.
In the C-terminal section; belongs to the flavoprotein pyridine nucleotide cytochrome reductase family.
In the N-terminal section; belongs to the flavodoxin family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length633
- Mass (Da)71,926
- Last updated2024-05-29 v2
- ChecksumD3A0C0496F6302FE
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A3S5ZP34 | A0A3S5ZP34_BOVIN | POR | 714 | ||
A0A3Q1MSC4 | A0A3Q1MSC4_BOVIN | POR | 648 | ||
A0A3Q1MQF2 | A0A3Q1MQF2_BOVIN | POR | 702 | ||
A0A3Q1M7U0 | A0A3Q1M7U0_BOVIN | POR | 681 |
Keywords
- Technical term