A0A3P8U565 · A0A3P8U565_AMPPE
- ProteinHedgehog protein
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids417 (go to sequence)
- Protein existenceInferred from homology
- Annotation score5/5
Function
function
Protein hedgehog N-product
The dually lipidated hedgehog protein N-product is a morphogen which is essential for a variety of patterning events during development.
Protein hedgehog
The C-terminal part of the hedgehog protein precursor displays an autoproteolysis activity that results in the cleavage of the full-length protein into two parts (N-product and C-product). In addition, the C-terminal part displays a cholesterol transferase activity that results by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-product.
Catalytic activity
- cholesterol + glycyl-L-cysteinyl-[protein] + H+ = [protein]-C-terminal glycyl cholesterol ester + N-terminal L-cysteinyl-[protein]This reaction proceeds in the forward direction.
Features
Showing features for binding site, site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 96 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 97 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 97 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 102 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 132 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 133 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 133 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 136 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 138 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 147 | Zn2+ (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 154 | Zn2+ (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 189 | Zn2+ (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Site | 204-205 | Cleavage; by autolysis | ||||
Sequence: GC | ||||||
Site | 250 | Involved in cholesterol transfer | ||||
Sequence: D | ||||||
Site | 274 | Involved in auto-cleavage | ||||
Sequence: T | ||||||
Site | 277 | Essential for auto-cleavage | ||||
Sequence: H |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum membrane | |
Cellular Component | extracellular space | |
Cellular Component | Golgi membrane | |
Cellular Component | plasma membrane | |
Molecular Function | calcium ion binding | |
Molecular Function | patched binding | |
Molecular Function | peptidase activity | |
Molecular Function | transferase activity | |
Biological Process | animal organ development | |
Biological Process | cell development | |
Biological Process | cell fate specification | |
Biological Process | cell-cell signaling | |
Biological Process | central nervous system development | |
Biological Process | intein-mediated protein splicing | |
Biological Process | neuron differentiation | |
Biological Process | pattern specification process | |
Biological Process | protein autoprocessing | |
Biological Process | regulation of cell population proliferation | |
Biological Process | regulation of developmental process | |
Biological Process | regulation of gene expression | |
Biological Process | smoothened signaling pathway | |
Biological Process | tissue development | |
Biological Process | tube development |
Keywords
- Molecular function
- Ligand
Names & Taxonomy
Protein names
- Recommended nameHedgehog protein
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Neoteleostei > Acanthomorphata > Ovalentaria > Pomacentridae > Amphiprion
Accessions
- Primary accessionA0A3P8U565
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Lipid-anchor
Sonic hedgehog protein
Protein hedgehog N-product
Cell membrane ; Lipid-anchor
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-30 | |||||
Sequence: MDPPRQSKMVLMRAMLSTLLCLLLASASWG | ||||||
Chain | PRO_5018076297 | 31-417 | Hedgehog protein | |||
Sequence: CGPGRGYGKRRHPKKLTPLALKQFIPNVAEKTLGASGKYEGKIIRNSERFKDLTPNYNPDIIFKDEENTNADRLMTQRCKDKLNSLAISVMNQWPGIKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDKSKYGMLSRLAVEAGFDWVYYESKAHIHCSVKAENSVAVKSGGCFPGSSMVILAEGNTKQLKDLQVGDKVLTADQRGNLVPSDFLMFIDQDQQISREFHVLETDEPCHRLKMTPAHLVFVMNNSTNSSSIRAMFASNVKPGQWLLVVGNDQSEYLIPARVTRVYVEKYEGSYAPMTSHGTIIVDRVLASCYAVVEDHDLAHWVFTPVRLWHSFLSLFGMVKELSSVHQADGVHWYPELLYYVGSWLLDRSSFHPQS |
Keywords
- PTM
Interaction
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 203-309 | Hint | ||||
Sequence: GGCFPGSSMVILAEGNTKQLKDLQVGDKVLTADQRGNLVPSDFLMFIDQDQQISREFHVLETDEPCHRLKMTPAHLVFVMNNSTNSSSIRAMFASNVKPGQWLLVVG | ||||||
Domain | 313-357 | Hint | ||||
Sequence: SEYLIPARVTRVYVEKYEGSYAPMTSHGTIIVDRVLASCYAVVED |
Sequence similarities
Belongs to the hedgehog family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length417
- Mass (Da)47,075
- Last updated2019-02-13 v1
- Checksum44A3931B614AA46F
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A3P8UEE7 | A0A3P8UEE7_AMPPE | 412 |
Keywords
- Technical term