A0A3B3ITP0 · A0A3B3ITP0_HUMAN
- ProteinProtein 4.1
- GeneEPB41
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids542 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cell cortex | |
Cellular Component | cytoskeleton | |
Cellular Component | nucleus | |
Molecular Function | actin binding | |
Molecular Function | calmodulin binding | |
Molecular Function | structural molecule activity | |
Biological Process | cell division |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameProtein 4.1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionA0A3B3ITP0
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 472 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
PTM/Processing
Features
Showing features for modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Modified residue (large scale data) | 13 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 250 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 285 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 301 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 331 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 333 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 342 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 346 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 350 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 351 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 369 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 490 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 527 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 537 | PRIDE | Phosphothreonine | ||||
Sequence: T |
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-282 | FERM | ||||
Sequence: MHCKVSLLDDTVYECVVEKHAKGQDLLKRVCEHLNLLEEDYFGLAIWDNATSKTWLDSAKEIKKQVRGVPWNFTFNVKFYPPDPAQLTEDITRYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELHGVDYVSDFKLAPNQTKELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMYGVDLHKAKDLEGVDIILGVCSSGLLVYKDKLRINRFPWPKVLKISYKRSSFFIKIRPGEQEQYESTIGFKLPSYRAAKKLWKVCVEHHTFFRLTS | ||||||
Region | 309-359 | Disordered | ||||
Sequence: RQASALIDRPAPHFERTASKRASRSLDGAAAVDSADRSPRPTSAPAITQGQ | ||||||
Region | 372-403 | Disordered | ||||
Sequence: KTVVPKAQKETVKAEVKKEDEPPEQAEPEPTE | ||||||
Compositional bias | 377-395 | Basic and acidic residues | ||||
Sequence: KAQKETVKAEVKKEDEPPE |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length542
- Mass (Da)60,540
- Last updated2018-12-05 v1
- Checksum12393946C10AE85A
Computationally mapped potential isoform sequences
There are 23 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
P11171 | EPB41_HUMAN | EPB41 | 864 | ||
A0A2R8Y7Y3 | A0A2R8Y7Y3_HUMAN | EPB41 | 601 | ||
A0A2R8Y7N0 | A0A2R8Y7N0_HUMAN | EPB41 | 565 | ||
A0A2R8Y783 | A0A2R8Y783_HUMAN | EPB41 | 310 | ||
A0A2R8Y6T6 | A0A2R8Y6T6_HUMAN | EPB41 | 364 | ||
A0A2R8Y6G5 | A0A2R8Y6G5_HUMAN | EPB41 | 680 | ||
A0A2R8Y420 | A0A2R8Y420_HUMAN | EPB41 | 544 | ||
A0A2R8Y6D0 | A0A2R8Y6D0_HUMAN | EPB41 | 542 | ||
A0A2R8Y5Z6 | A0A2R8Y5Z6_HUMAN | EPB41 | 787 | ||
A0A2R8Y5G2 | A0A2R8Y5G2_HUMAN | EPB41 | 782 | ||
A0A2R8Y5C8 | A0A2R8Y5C8_HUMAN | EPB41 | 227 | ||
A0A2R8Y570 | A0A2R8Y570_HUMAN | EPB41 | 766 | ||
A0A2R8Y4N6 | A0A2R8Y4N6_HUMAN | EPB41 | 387 | ||
A0A2R8YCW8 | A0A2R8YCW8_HUMAN | EPB41 | 748 | ||
A0A2R8YD30 | A0A2R8YD30_HUMAN | EPB41 | 655 | ||
A0A2R8YFU8 | A0A2R8YFU8_HUMAN | EPB41 | 161 | ||
A0A2R8YFR9 | A0A2R8YFR9_HUMAN | EPB41 | 675 | ||
A0A2U3TZH6 | A0A2U3TZH6_HUMAN | EPB41 | 841 | ||
A0A1B0GWG0 | A0A1B0GWG0_HUMAN | EPB41 | 483 | ||
A0A3B3IU06 | A0A3B3IU06_HUMAN | EPB41 | 807 | ||
A0A3B3ITC5 | A0A3B3ITC5_HUMAN | EPB41 | 481 | ||
A0A3B3IUD6 | A0A3B3IUD6_HUMAN | EPB41 | 607 | ||
A0A994J847 | A0A994J847_HUMAN | EPB41 | 828 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 377-395 | Basic and acidic residues | ||||
Sequence: KAQKETVKAEVKKEDEPPE |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL009181 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL138785 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL357500 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |