A0A3B3ISJ6 · A0A3B3ISJ6_HUMAN
- ProteinPhosphodiesterase
- GenePDE10A
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids791 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
Cofactor
Note: Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions.
Features
Showing features for active site, binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 527 | Proton donor | ||||
Sequence: H | ||||||
Binding site | 527-531 | AMP (UniProtKB | ChEBI) | ||||
Sequence: HNWKH | ||||||
Binding site | 531 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 565 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 566 | AMP (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 566 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 566 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 676 | AMP (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 676 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 728 | AMP (UniProtKB | ChEBI) | ||||
Sequence: Q |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | 3',5'-cyclic-nucleotide phosphodiesterase activity | |
Molecular Function | metal ion binding | |
Biological Process | signal transduction |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePhosphodiesterase
- EC number
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionA0A3B3ISJ6
Proteomes
Organism-specific databases
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 487 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for compositional bias, region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-16 | Polar residues | ||||
Sequence: MEGSTAWSSEAEPQEG | ||||||
Region | 1-23 | Disordered | ||||
Sequence: MEGSTAWSSEAEPQEGRSQMLQR | ||||||
Domain | 454-771 | PDEase | ||||
Sequence: TSEEWQGLMQFTLPVRLCKEIELFHFDIGPFENMWPGIFVYMVHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNHTLFTDLERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQSHRDRVIGLMMTACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKDEVPQGQLGFYNAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGE |
Sequence similarities
Belongs to the cyclic nucleotide phosphodiesterase family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length791
- Mass (Da)89,552
- Last updated2018-12-05 v1
- Checksum144276319F8DF444
Computationally mapped potential isoform sequences
There are 15 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q9Y233 | PDE10_HUMAN | PDE10A | 1055 | ||
A0A1B1UZQ1 | A0A1B1UZQ1_HUMAN | PDE10A | 709 | ||
A0AAA9X175 | A0AAA9X175_HUMAN | PDE10A | 505 | ||
A0A5F9ZI67 | A0A5F9ZI67_HUMAN | PDE10A | 806 | ||
A0A5F9ZHF9 | A0A5F9ZHF9_HUMAN | PDE10A | 820 | ||
A0A3B3IRU7 | A0A3B3IRU7_HUMAN | PDE10A | 772 | ||
A0A3B3IS50 | A0A3B3IS50_HUMAN | PDE10A | 52 | ||
A0A3B3IT18 | A0A3B3IT18_HUMAN | PDE10A | 93 | ||
A0A3B3ITT8 | A0A3B3ITT8_HUMAN | PDE10A | 847 | ||
A0A3B3IRL3 | A0A3B3IRL3_HUMAN | PDE10A | 60 | ||
A0A7I2YQI4 | A0A7I2YQI4_HUMAN | PDE10A | 93 | ||
A0A7I2YQV2 | A0A7I2YQV2_HUMAN | PDE10A | 802 | ||
A0A087WUD0 | A0A087WUD0_HUMAN | PDE10A | 183 | ||
A0A7I2V301 | A0A7I2V301_HUMAN | PDE10A | 308 | ||
A0A7I2V618 | A0A7I2V618_HUMAN | PDE10A | 349 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-16 | Polar residues | ||||
Sequence: MEGSTAWSSEAEPQEG |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL117345 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL121789 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL136130 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL160160 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL590302 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL591962 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
KF458352 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
KF458359 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
KU232567 EMBL· GenBank· DDBJ | AMN14870.1 EMBL· GenBank· DDBJ | mRNA |